• Featured Product
  • KD/KO Validated

IL-6 Monoclonal antibody

IL-6 antibodies are used for both research and therapeutic purposes to detect, quantify, and block the activity of interleukin-6 (IL-6), a cytokine central to immune regulation, inflammation, hematopoiesis, and cancer biology. Proteintech has an extensive range of IL-6 antibodies validated for WB, IHC, IF/ICC, IP, Neutralization, ELISA and more.
Cat No. 66146-1-Ig
Clone No.1A3B4

Host / Isotype

Mouse / IgG2b

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, ELISA

IL6, Interferon beta-2, IL 6, IFN-beta-2, B-cell stimulatory factor 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inU-87 MG cells, Recombinant protein, Jurkat cells, HUVEC cells
Positive IF/ICC detected inLPS and Brefeldin A treated HUVEC cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66146-1-Ig targets IL-6 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, pig, sheep
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag10646

Product name: Recombinant human IL-6 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-212 aa of BC015511

Sequence: MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Predict reactive species
Full Name interleukin 6 (interferon, beta 2)
Calculated Molecular Weight 212 aa, 24 kDa
Observed Molecular Weight24 kDa
GenBank Accession NumberBC015511
Gene Symbol IL6
Gene ID (NCBI) 3569
ENSEMBL Gene IDENSG00000136244
RRIDAB_2881543
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP05231
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Interleukin-6 (IL-6) is an interleukin that acts as both a pro-inflammatory and anti-inflammatory cytokine. IL-6 protein is secreted by a variety of cell types including T cells and macrophages as phosphorylated and variably glycosylated molecule. IL-6 plays an essential role in the final differentiation of B-cells into Ig-secreting cells involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. IL-6 is also considered a myokine, a cytokine produced from muscle, and is elevated in response to muscle contraction. IL-6 has been shown to interact with interleukin-6 receptor and glycoprotein 130. Additionally, IL-6 is involved in hematopoiesis, bone metabolism, and cancer progression, and has been defined an essential role in directing transition from innate to acquired immunity.

Protocols

Product Specific Protocols
IF protocol for IL-6 antibody 66146-1-IgDownload protocol
WB protocol for IL-6 antibody 66146-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell Metab

Lighting up arginine metabolism reveals its functional diversity in physiology and pathology

Authors - Rui Li
humanWB

Nat Aging

Single-cell and spatial RNA sequencing identify divergent microenvironments and progression signatures in early- versus late-onset prostate cancer

Authors - Yifei Cheng
pigIHC

Bioact Mater

Angiogenesis, hemocompatibility and bactericidal effect of bioactive natural polymer-based bilayer adhesive skin substitute for infected burned wound healing

Authors - Mina Shahriari-Khalaji
humanWB

Nat Commun

A stress-induced cilium-to-PML-NB route drives senescence initiation

Authors - Xiaoyu Ma
WB

Acta Pharm Sin B

Ligand-based substituent-anchoring design of selective receptor-interacting protein kinase 1 necroptosis inhibitors for ulcerative colitis therapy

Authors - Jing Zhu
IF

Nat Commun

Catalytically potent and selective clusterzymes for modulation of neuroinflammation through single-atom substitutions.

Authors - Haile Liu
Loading...
||
New chat Able
正在加载,请稍候...