IL-6 Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 83747-1-PBS

  Biolayer interferometry (BLl) kinetic assay of 83747-1-PBS against Human IL-6 was performed. The affinity constant is 1.56 nM.

IL-6 antibodies are used for both research and therapeutic purposes to detect, quantify, and block the activity of interleukin-6 (IL-6), a cytokine central to immune regulation, inflammation, hematopoiesis, and cancer biology. Proteintech has an extensive range of IL-6 antibodies validated for WB, IHC, IF/ICC, IP, Neutralization, ELISA and more.

Cat No. 83747-1-PBS

Clone No.240669E11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

IL6, B-cell stimulatory factor 2, IFN-beta-2, IL 6, Interferon beta-2

---

Product Information

83747-1-PBS targets IL-6 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0117

  Product name: Recombinant Human IL-6 protein (Myc Tag, His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: Myc & 6*His

  Domain: 30-212 aa of BC015511

  Sequence: VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

• Full Name: interleukin 6 (interferon, beta 2)
• Calculated Molecular Weight: 212 aa, 24 kDa
• GenBank Accession Number: BC015511
• Gene Symbol: IL6
• Gene ID (NCBI): 3569
• ENSEMBL Gene ID: ENSG00000136244
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P05231
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.