CD126/IL-6R alpha Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA sample test of MP00676-1

  Urine of eight humans was measured. The human IL6R/IL-6R alpha concentration of these samples was determined to be 1,291.5 pg/mL, with a range of 119.4 - 5,099.9 pg/mL.

• 

  Sandwich ELISA sample test of MP00676-1

  Human peripheral blood mononuclear cells (PBMC) (1 x 10^6 cells/mL) were cultured in DMEM supplemented with 8% fetal bonive serum, 5μM β-mercaptoethanol, 2 mM L-glutamine, 100 U/mL penicillin, and 100 μg/mL streptomycin sulfate. Cells were cultured unstimulated or stimulated with 10 μg/mL PHA for 1day, 4 days and 5 days. Aliquots of the cell culture supernates were removed and assayed for levels of human IL6.

• 

  Sandwich ELISA sample test of MP00676-1

  Serum of sixteen humans was measured. The human IL6R/IL-6R alpha concentration of these samples was determined to be 60,089 pg/mL, with a range of 37,850.6 - 124,335.2 pg/mL.

• 

  Sandwich ELISA standard curve of MP00676-1

  Sandwich ELISA standard curve of MP00676-1, Human IL6R/IL-6R alpha Recombinant Matched Antibody Pair - PBS only. 83688-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg0490. 83688-2-PBS was HRP conjugated as the detection antibody. Range: 7.8-500 pg/mL

• 

  Cytometric bead array standard curve of MP00676-1

  Cytometric bead array standard curve of MP00676-1, CD126/IL-6R alpha Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 83688-3-PBS. Detection antibody: 83688-2-PBS. Standard: Eg0490. Range: 0.625-80 ng/mL.

• 

  Affinity and Kinetic Characterization of 83688-3-PBS

  Biolayer interferometry (BLl) kinetic assays of 83688-3-PBS against Human CD126/IL-6R alpha were performed. The affinity constant is 0.515 nM.

CD126/IL-6R alpha Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 83688-3-PBS

Clone No.240734A8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

CD126, IL-6R alpha, gp80, IL 6 receptor subunit alpha, IL 6R 1

---

Product Information

83688-3-PBS targets CD126/IL-6R alpha as part of a matched antibody pair:

MP00676-1: 83688-3-PBS capture and 83688-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0490

  Product name: Recombinant Human CD126/IL-6R alpha protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 20-365 aa of BC132684

  Sequence: LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLP

• Full Name: interleukin 6 receptor
• Calculated Molecular Weight: 468 aa, 52 kDa
• GenBank Accession Number: BC132684
• Gene Symbol: IL-6R alpha
• Gene ID (NCBI): 3570
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P08887
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.