Tested Applications
| Positive WB detected in | mouse thymus tissue, K-562 cells |
| Positive IP detected in | K-562 cells |
| Positive IF-P detected in | mouse spleen tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3600 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
17626-1-AP targets IL-7Ra/CD127 in WB, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11844 Product name: Recombinant human IL-7R protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 266-459 aa of BC067537 Sequence: KRIKPIVWPSLPDHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPESFGRDSSLTCLAGNVSACDAPILSPSRSLDCRESGKNGPHVYQDLLLSLGTTNSTLPPPFSLQSGILTLNPVAQGQPILTSLGSNQEEAYVTMSSFYQNQ Predict reactive species |
| Full Name | interleukin 7 receptor |
| Calculated Molecular Weight | 459 aa, 52 kDa |
| Observed Molecular Weight | 56-58 kDa |
| GenBank Accession Number | BC067537 |
| Gene Symbol | CD127 |
| Gene ID (NCBI) | 3575 |
| ENSEMBL Gene ID | ENSG00000168685 |
| RRID | AB_2126105 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P16871 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CD127, also known as IL-7R subunit alpha (IL-7RA), is a type I membrane glycoprotein expressed on thymocytes, B cell precursors, most T cells, and some lymphoid and myeloid cells. IL-7R is a heterodimer composed of CD127 and the common-γ chain receptor (CD132). IL-7R plays critical roles in lymphocyte development and homeostasis. CD127 can also act as a receptor for thymic stromal lymphopoietin (TSLP).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for IL-7Ra/CD127 antibody 17626-1-AP | Download protocol |
| IP protocol for IL-7Ra/CD127 antibody 17626-1-AP | Download protocol |
| WB protocol for IL-7Ra/CD127 antibody 17626-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The IL-7Ra/CD127 Polyclonal antibody (Cat# 17626-1-AP) has 8 total citations. These appear in journals including Molecular Cancer, Journal for ImmunoTherapy of Cancer, Journal of Translational Medicine, Molecular Medicine Reports, iScience, Clinical and Experimental Immunology, Journal of Mammary Gland Biology and Neoplasia, and Clinical, Cosmetic and Investigational Dermatology. Research fields span anti-tumor immunity, gastric cancer immunosuppression, colorectal cancer, T-cell lineage commitment, thymic microenvironment, breast cancer, and inflammatory/autoimmune conditions.
| Species | Application | Title |
|---|---|---|
Mol Cancer Targeting BATF2-RGS2 axis reduces T-cell exhaustion and restores anti-tumor immunity | ||
J Immunother Cancer CD146+ CAFs mediate immunosuppression in gastric cancer via COL4A1: potential therapeutic targets | ||
J Transl Med Human mesenchymal stem cell-derived miR-3614-5p exosomes suppress progression of colorectal cancer by targeting IL7Rα. | ||
Mol Med Rep TET2 is involved in DNA hydroxymethylation, cell proliferation and inflammatory response in keratinocytes. | ||
iScience Translation factor eIF4G2 directs CD8(+) T cell lineage commitment by selectively enabling the IL-7 receptor response. | ||
Clin Exp Immunol Deletion of Thymic Myoid Cells Regulates the Thymic Microenvironment Involved in the Progression of Tumor-Associated Myasthenia Gravis |
Reviews
What customers say
One review rated this antibody 3/5 stars. The user performed Western blotting on mouse spleen B cell protein extracts using an 8% polyacrylamide gel, transferring to nitrocellulose membrane blocked with 5% BSA. The primary antibody was used at a 1:500 dilution overnight at 4°C, followed by an anti-rabbit HRP secondary. No specific issues or praise were mentioned beyond describing the protocol.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Bastien (Verified Customer) (08-19-2020) | Western blotting of protein from B cells of mice spleen. Protein extract was loaded on 8 % polyacrylamide gel and then transfert on nitrocellulose membrane. Nitrocellulose membrane was blocked with 5% BSA during 1h. Membrane was then incubated overnight at 4°C with 1/500 IL7Ra antibody (17626-1-AP). Finally, the membrane was incubated with anti-rabbit-HRP (clean blot IPdetection reagent from thermofisher)
 |
