Use Able AI chat for product recommendations

IL-7Ra/CD127 Polyclonal antibody

IL-7Ra/CD127 Polyclonal Antibody for WB, IF-P, IP, ELISA

Cat No. 17626-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF-P, IP, ELISA

CD127, IL7 receptor subunit alpha, IL 7RA, IL 7R subunit alpha, IL 7R alpha

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse thymus tissue, K-562 cells
Positive IP detected inK-562 cells
Positive IF-P detected inmouse spleen tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3600
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17626-1-AP targets IL-7Ra/CD127 in WB, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag11844

Product name: Recombinant human IL-7R protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 266-459 aa of BC067537

Sequence: KRIKPIVWPSLPDHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPESFGRDSSLTCLAGNVSACDAPILSPSRSLDCRESGKNGPHVYQDLLLSLGTTNSTLPPPFSLQSGILTLNPVAQGQPILTSLGSNQEEAYVTMSSFYQNQ

Predict reactive species
Full Name interleukin 7 receptor
Calculated Molecular Weight 459 aa, 52 kDa
Observed Molecular Weight 56-58 kDa
GenBank Accession NumberBC067537
Gene Symbol CD127
Gene ID (NCBI) 3575
ENSEMBL Gene IDENSG00000168685
RRIDAB_2126105
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP16871
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD127, also known as IL-7R subunit alpha (IL-7RA), is a type I membrane glycoprotein expressed on thymocytes, B cell precursors, most T cells, and some lymphoid and myeloid cells. IL-7R is a heterodimer composed of CD127 and the common-γ chain receptor (CD132). IL-7R plays critical roles in lymphocyte development and homeostasis. CD127 can also act as a receptor for thymic stromal lymphopoietin (TSLP).

Protocols

Product Specific Protocols
IF protocol for IL-7Ra/CD127 antibody 17626-1-APDownload protocol
IP protocol for IL-7Ra/CD127 antibody 17626-1-APDownload protocol
WB protocol for IL-7Ra/CD127 antibody 17626-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouseWB

Clin Exp Immunol

Deletion of Thymic Myoid Cells Regulates the Thymic Microenvironment Involved in the Progression of Tumor-Associated Myasthenia Gravis

Authors - Bo Hu
human,mouseWB

J Mammary Gland Biol Neoplasia

TGFß1 Stimulates Lymphatic Endothelial Cells to Produce IL7 and IL15, Which Act as Chemotactic Factors for Breast Cancer Cells with Mesenchymal Properties

Authors - Nikolina Giotopoulou
humanWB

Mol Med Rep

TET2 is involved in DNA hydroxymethylation, cell proliferation and inflammatory response in keratinocytes.

Authors - Xinxin Liu

J Transl Med

Human mesenchymal stem cell-derived miR-3614-5p exosomes suppress progression of colorectal cancer by targeting IL7Rα.

Authors - Mengling Ye
humanWB

J Immunother Cancer

CD146+ CAFs mediate immunosuppression in gastric cancer via COL4A1: potential therapeutic targets

Authors - Jia Chen
mouseWB

Mol Cancer

Targeting BATF2-RGS2 axis reduces T-cell exhaustion and restores anti-tumor immunity

Authors - Xuyu Gu

Reviews

    3.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Bastien (Verified Customer) (08-19-2020)

Western blotting of protein from B cells of mice spleen. Protein extract was loaded on 8 % polyacrylamide gel and then transfert on nitrocellulose membrane. Nitrocellulose membrane was blocked with 5% BSA during 1h. Membrane was then incubated overnight at 4°C with 1/500 IL7Ra antibody (17626-1-AP). Finally, the membrane was incubated with anti-rabbit-HRP (clean blot IPdetection reagent from thermofisher)

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/500
  • Cell Tissue Type: B cells
IL-7Ra/CD127 Antibody Western Blot validation (1/500 dilution) in B cells (Cat no:17626-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...