IL-7Ra/CD127 Polyclonal antibody

• 

  WB analysis of mouse thymus using 17626-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 17626-1-AP (IL-7Ra/CD127 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 17626-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 17626-1-AP (CD127/IL7R antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of K-562 using 17626-1-AP

  IP result of anti-IL-7Ra/CD127 (IP:17626-1-AP, 4ug; Detection:17626-1-AP 1:1000) with K-562 cells lysate 1200ug.

• 

  IF Staining of mouse spleen using 17626-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse spleen tissue using IL-7Ra/CD127 antibody (17626-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

IL-7Ra/CD127 Polyclonal Antibody for WB, IF-P, IP, ELISA

Cat No. 17626-1-AP

Publications(5)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF-P, IP, ELISA

Synonyms

CD127, IL7 receptor subunit alpha, IL 7RA, IL 7R subunit alpha, IL 7R alpha

---

Tested Applications

• Positive WB detected in: mouse thymus tissue, K-562 cells
• Positive IP detected in: K-562 cells
• Positive IF-P detected in: mouse spleen tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3600
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below

Product Information

17626-1-AP targets IL-7Ra/CD127 in WB, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11844

  Product name: Recombinant human IL-7R protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 266-459 aa of BC067537

  Sequence: KRIKPIVWPSLPDHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPESFGRDSSLTCLAGNVSACDAPILSPSRSLDCRESGKNGPHVYQDLLLSLGTTNSTLPPPFSLQSGILTLNPVAQGQPILTSLGSNQEEAYVTMSSFYQNQ

• Full Name: interleukin 7 receptor
• Calculated Molecular Weight: 459 aa, 52 kDa
• Observed Molecular Weight: 56-58 kDa
• GenBank Accession Number: BC067537
• Gene Symbol: CD127
• Gene ID (NCBI): 3575
• ENSEMBL Gene ID: ENSG00000168685
• RRID: AB_2126105
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P16871
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD127, also known as IL-7R subunit alpha (IL-7RA), is a type I membrane glycoprotein expressed on thymocytes, B cell precursors, most T cells, and some lymphoid and myeloid cells. IL-7R is a heterodimer composed of CD127 and the common-γ chain receptor (CD132). IL-7R plays critical roles in lymphocyte development and homeostasis. CD127 can also act as a receptor for thymic stromal lymphopoietin (TSLP).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Clin Exp Immunol; Deletion of Thymic Myoid Cells Regulates the Thymic Microenvironment Involved in the Progression of Tumor-Associated Myasthenia Gravis; Authors - Bo Hu
human,mouse	WB	J Mammary Gland Biol Neoplasia; TGFß1 Stimulates Lymphatic Endothelial Cells to Produce IL7 and IL15, Which Act as Chemotactic Factors for Breast Cancer Cells with Mesenchymal Properties; Authors - Nikolina Giotopoulou
human	WB	Mol Med Rep; TET2 is involved in DNA hydroxymethylation, cell proliferation and inflammatory response in keratinocytes.; Authors - Xinxin Liu
human	WB	Clin Cosmet Investig Dermatol; Identification of a Gene Expression Signature to Predict the Risk of Abdominal Aortic Aneurysm in Psoriasis Patients; Authors - Xintong Lyu
mouse	WB	Mol Cancer; Targeting BATF2-RGS2 axis reduces T-cell exhaustion and restores anti-tumor immunity; Authors - Xuyu Gu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Bastien (Verified Customer) (08-19-2020)

Western blotting of protein from B cells of mice spleen. Protein extract was loaded on 8 % polyacrylamide gel and then transfert on nitrocellulose membrane. Nitrocellulose membrane was blocked with 5% BSA during 1h. Membrane was then incubated overnight at 4°C with 1/500 IL7Ra antibody (17626-1-AP). Finally, the membrane was incubated with anti-rabbit-HRP (clean blot IPdetection reagent from thermofisher)

• Applications: Western Blot
• Primary Antibody Dilution: 1/500
• Cell Tissue Type: B cells

IL-7Ra/CD127 Antibody Western Blot validation (1/500 dilution) in B cells (Cat no:17626-1-AP)