IL-7Ra/CD127 Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 83723-1-PBS

  Biolayer interferometry (BLl) kinetic assay of 83723-1-PBS against Human IL-7Ra/CD127 was performed. The affinity constant is 5.23 nM.

IL-7Ra/CD127 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 83723-1-PBS

Clone No.240749B2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

CD127, IL 7 receptor subunit alpha, IL 7R alpha, IL 7R subunit alpha, IL 7RA

---

Product Information

83723-1-PBS targets IL-7Ra/CD127 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1279

  Product name: Recombinant Human IL-7RA/CD127 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 21-239 aa of AAC83204.1

  Sequence: ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNTTNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVIYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMD

• Full Name: interleukin 7 receptor
• Calculated Molecular Weight: 52 kDa
• GenBank Accession Number: AAC83204.1
• Gene Symbol: CD127
• Gene ID (NCBI): 3575
• ENSEMBL Gene ID: ENSG00000168685
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P16871-1(I66T, V138I)
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.