ILK Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ILK Polyclonal antibody (12955-1-AP)

• KD/KO Validated

ILK Polyclonal Antibody for WB, IP, ELISA

Cat No. 12955-1-AP Copied!

Publications (17)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

59 kDa serine/threonine-protein kinase, Beta-integrin-linked kinase, EC:2.7.11.1, ILK 1, ILK 2

• 

  WB analysis using 12955-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12955-1-AP (ILK antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of U2OS using 12955-1-AP

  WB result of ILK antibody (12955-1-AP; 1:400; incubated at room temperature for 1.5 hours) with sh-Control and sh-ILK transfected U2OS cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse kidney using 12955-1-AP

  IP result of anti-ILK (IP:12955-1-AP, 4ug; Detection:12955-1-AP 1:800) with mouse kidney tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ILK in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse kidney tissue
• Positive IP detected in: mouse kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12955-1-AP targets ILK in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3570

  Product name: Recombinant human ILK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 102-451 aa of BC001554

  Sequence: VPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQD

• Full Name: integrin-linked kinase
• Calculated Molecular Weight: 452 aa, 51 kDa
• Observed Molecular Weight: 51-59 kDa
• GenBank Accession Number: BC001554
• Gene Symbol: ILK
• Gene ID (NCBI): 3611
• RRID: AB_2127053
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13418
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Integrin-linked kinase (ILK) is an ankyrin-repeat containing serine-threonine protein kinase capable of interacting with the cytoplasmic domains of integrin β1, β2, and β3 subunits and whose kinase activity is modulated by cell-extracellular matrix interactions (PMID: 9539744). This protein belongs to the protein kinase superfamily. It can be autophosphorylated on serine residues.

Publications

What published studies show

The ILK Polyclonal antibody (Cat# 12955-1-AP) has 17 citations published in journals including Nature Communications, Advanced Science, Cell Reports, FASEB Journal, Cell Death Discovery, International Immunopharmacology, Science of the Total Environment, and BMC Gastroenterology. Associated research fields include ubiquitination, cardiac repair, colorectal and breast cancer, pulmonary fibrosis, rheumatoid arthritis, EMT, osteoporosis, renal cell carcinoma, ovarian cancer, and kidney disease.

Automatically generated from the 17 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; Systematic HOIP interactome profiling reveals critical roles of linear ubiquitination in tissue homeostasis; Authors - Yesheng Fu
human	WB	Adv Sci (Weinh); Injectable pH Responsive Conductive Hydrogel for Intelligent Delivery of Metformin and Exosomes to Enhance Cardiac Repair after Myocardial Ischemia-Reperfusion Injury; Authors - Nianlan Cheng
mouse,human	WB	Mol Biomed; Multi-omics factor analysis identifies the Tensin 1-Fermitin family homologue 2-Fibronectin 1-Integrin signaling axis as a prognostic determinant in colorectal cancer.; Authors - Tianwei Chen
mouse	WB	Cell Death Discov; Inhibition of the ILK-AKT pathway by upregulation of PARVB contributes to the cochlear cell death in Fascin2 gene knockout mice; Authors - Rongrong Liu
	WB	Cell Death Discov; Anaerobic metabolism promotes breast cancer survival via Histone-3 Lysine-18 lactylation mediating PPARD axis; Authors - Ying Xu
pig	WB,IP	Sci Total Environ; Protein lysine acetylation played an important role in NH3-induced AEC2 damage and pulmonary fibrosis in piglets; Authors - Xiaotong Wang