ILK Polyclonal antibody

• 

  WB analysis using 12955-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12955-1-AP (ILK antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse kidney using 12955-1-AP

  IP result of anti-ILK (IP:12955-1-AP, 4ug; Detection:12955-1-AP 1:800) with mouse kidney tissue lysate 4000ug.

• 

  IHC staining of human prostate cancer using 12955-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 12955-1-AP (ILK antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

ILK Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 12955-1-AP

Publications(14)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

ILK, ILK 1, ILK 2, ILK1, ILK2, P59, p59ILK

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse kidney tissue
• Positive IP detected in: mouse kidney tissue
• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 12 publications below
• IHC: See 2 publications below
• IF: See 2 publications below
• IP: See 2 publications below

Product Information

12955-1-AP targets ILK in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3570

  Product name: Recombinant human ILK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 102-451 aa of BC001554

  Sequence: VPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQD

• Full Name: integrin-linked kinase
• Calculated Molecular Weight: 451 aa, 59 kDa
• Observed Molecular Weight: 51-59 kDa
• GenBank Accession Number: BC001554
• Gene Symbol: ILK
• Gene ID (NCBI): 3611
• RRID: AB_2127053
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13418
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Integrin-linked kinase (ILK) is an ankyrin-repeat containing serine-threonine protein kinase capable of interacting with the cytoplasmic domains of integrin β1, β2, and β3 subunits and whose kinase activity is modulated by cell-extracellular matrix interactions (PMID: 9539744). This protein belongs to the protein kinase superfamily. It can be autophosphorylated on serine residues.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
pig	WB,IP	Sci Total Environ; Protein lysine acetylation played an important role in NH3-induced AEC2 damage and pulmonary fibrosis in piglets; Authors - Xiaotong Wang
human	IP	FASEB J; Coiled-coil domain containing 25 (CCDC25) regulates cell proliferation, migration, and invasion in clear cell renal cell carcinoma by targeting the ILK-NF-κB signaling pathway; Authors - Zhenzhen Qian
human	WB	J Cancer; GTW inhibits the Epithelial to Mesenchymal Transition of Epithelial Ovarian Cancer via ILK/AKT/GSK3β/Slug Signalling Pathway.; Authors - Ying Feng
human	WB	Int Immunopharmacol; BML-111 inhibits EMT, migration and metastasis of TAMs-stimulated triple-negative breast cancer cells via ILK pathway.; Authors - Lan Lin
human	IHC	BMC Gastroenterol; Identification and validation of EMT-immune-related prognostic biomarkers CDKN2A, CMTM8 and ILK in colon cancer.; Authors - Ning Kang
mouse	WB,IF	PLoS One; Cleavage of periostin by MMP9 protects mice from kidney cystic disease; Authors - Nabila Djaziri