ILK Monoclonal antibody

• 

  WB analysis using 67724-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67724-1-Ig (ILK antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

• 

  WB analysis of human peripheral blood platelets using 67724-1-Ig

  human peripheral blood platelets were subjected to SDS PAGE followed by western blot with 67724-1-Ig (ILK antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 67724-1-Ig

  human placenta tissue were subjected to SDS PAGE followed by western blot with 67724-1-Ig (ILK antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig colon using 67724-1-Ig

  pig colon tissue were subjected to SDS PAGE followed by western blot with 67724-1-Ig (ILK antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse colon using 67724-1-Ig

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 67724-1-Ig (ILK antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat colon using 67724-1-Ig

  rat colon tissue were subjected to SDS PAGE followed by western blot with 67724-1-Ig (ILK antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human skin cancer using 67724-1-Ig

  Immunohistochemical analysis of paraffin-embedded skin cancer slide using 67724-1-Ig (ILK antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

ILK Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67724-1-Ig

Clone No.1E10E4

Publications(2)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

ILK 2, ILK 1, EC:2.7.11.1, Beta-integrin-linked kinase, 59 kDa serine/threonine-protein kinase

---

Tested Applications

• Positive WB detected in: U2OS cells, human placenta tissue, human peripheral blood platelets, rat colon tissue, mouse colon tissue, pig colon tissue, HepG2 cells, HeLa cells, HEK-293 cells, K-562 cells
• Positive IHC detected in: human skin cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IF: See 1 publications below
• IP: See 1 publications below
• CoIP: See 1 publications below

Product Information

67724-1-Ig targets ILK in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21289

  Product name: Recombinant human ILK protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 102-451 aa of BC001554

  Sequence: VPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQD

• Full Name: integrin-linked kinase
• Calculated Molecular Weight: 451 aa, 59 kDa
• Observed Molecular Weight: 51 kDa
• GenBank Accession Number: BC001554
• Gene Symbol: ILK
• Gene ID (NCBI): 3611
• RRID: AB_2882910
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q13418
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ILK(Integrin-linked protein kinase) is also named as p59, PAT-4, DKFZp686F1765, ILK-1, ILK-2, ILK1, ILK2, p59ILK and belongs to the TKL Ser/Thr protein kinase family. This protein localizes to multiple sites, including the cytoplasm, and imports into the nucleus through sequences in its N-terminus, via active transport mechanisms that involve nuclear pore complexes(PMID: 18635968). ILK performs crucial roles in the control of intestinal cell and crypt-villus axis homeostasis-especially with regard to basement membrane fibronectin deposition-as well as cell proliferation, spreading, and migration(PMID:19885839).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF,CoIP	Cell Rep Med; Targeting mitochondrial complex I of CD177+ neutrophils alleviates lung ischemia-reperfusion injury; Authors - Junqi Wu
human	WB,IP	Nat Commun; Systematic HOIP interactome profiling reveals critical roles of linear ubiquitination in tissue homeostasis; Authors - Yesheng Fu