ILVBL Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ILVBL Polyclonal antibody (11220-1-AP)

ILVBL Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11220-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

209L8, 2-hydroxyacyl-CoA lyase 2, Acetolactate synthase-like protein, AHAS, EC:4.1.2.-

• 

  WB analysis using 11220-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11220-1-AP (ILVBL antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human thyroid gland using 11220-1-AP

  human thyroid gland tissue were subjected to SDS PAGE followed by western blot with 11220-1-AP (ILVBL antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 11220-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11220-1-AP (ILVBL antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 11220-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11220-1-AP (ILVBL antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 11220-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11220-1-AP (ILVBL antibody) at dilution of 1:1600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 11220-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using ILVBL antibody (11220-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ILVBL in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, human thyroid gland tissue, HepG2 cells, HeLa cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1500-1:6000
• Immunohistochemistry (IHC): IHC : 1:800-1:3200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11220-1-AP targets ILVBL in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1729

  Product name: Recombinant human ILVBL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 284-632 aa of BC011761

  Sequence: KRPLMVLGSQALLTPTSADKLRAAVETLGVPCFLGGMARGLLGRNHPLHIRENRSAALKKADVIVLAGTVCDFRLSYGRVLSHSSKIIIVDRNREEMLLNSDIFWKPQEAVQGDVGSFVLKLVEGLQGQTWAPDWVEELREADRQKEQTFREKAAMPVAQHLNPVQVLQLVEETLPDNSILVVDGGDFVGTAAHLVQPRGPLRWLDPGAFGTLGVGAGFALGAKLCRPDAEVWCLFGDGAFGYSLIEFDTFVRHKIPVMALVGNDAGWTQISREQVPSLGSNVACGLAYTDYHKAAMGLGARGLLLSRENEDQVVKVLHDAQQQCRDGHPVVVNILIGRTDFRDGSIAV

• Full Name: ilvB (bacterial acetolactate synthase)-like
• Calculated Molecular Weight: 68 kDa
• Observed Molecular Weight: 60-65 kDa
• GenBank Accession Number: BC011761
• Gene Symbol: ILVBL
• Gene ID (NCBI): 10994
• RRID: AB_2127187
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: A1L0T0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The ILVBL Polyclonal antibody (Cat# 11220-1-AP) has 2 citations. One appeared in Nature Neuroscience (IF 20.3), studying how UBQLN2 links proteotoxicity with lipid metabolism in neurodegeneration. The other was published in Nature Communications (IF 18.1), investigating the EMC complex as a chaperone for membrane proteins, using WB in human samples. The associated research fields span neurodegeneration and membrane protein biogenesis.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Nat Neurosci; UBQLN2 links proteotoxicity with lipid metabolism in neurodegeneration; Authors - Yang Liu
human	WB	Nat Commun; The EMC acts as a chaperone for membrane proteins; Authors - Carolin J Klose