IMP3 Polyclonal antibody

• 

  WB analysis using 12750-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12750-1-AP (IMP3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 12750-1-AP

  WB result of IMP3 antibody (12750-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-IMP3 transfected HeLa cells.

• 

  IP experiment of HeLa using 12750-1-AP

  IP result of anti-IMP3 (IP:12750-1-AP, 3ug; Detection:12750-1-AP 1:500) with HeLa cells lysate 1200ug.

• 

  IHC staining of human ovary cancer using 12750-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 12750-1-AP (IMP3 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 12750-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using IMP3 antibody (12750-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• Featured Product
• KD/KO Validated

IMP3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 12750-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

MRPS4, IMP 3, C15orf12, BRMS2

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below

Product Information

12750-1-AP targets IMP3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3477

  Product name: Recombinant human IMP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-184 aa of BC020557

  Sequence: MVRKLKFHEQKLLKQVDFLNWEVTDHNLHELRVLRRYRLQRREDYTRYNQLSRAVRELARRLRDLPERDQFRVRASAALLDKLYALGLVPTRGSLELCDFVTASSFCRRRLPTVLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLEA

• Full Name: IMP3, U3 small nucleolar ribonucleoprotein, homolog (yeast)
• Calculated Molecular Weight: 184 aa, 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC020557
• Gene Symbol: IMP3
• Gene ID (NCBI): 55272
• RRID: AB_2122784
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NV31
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IMP U3 small nucleolar ribonucleoprotein 3 (IMP3, BRMS2), is a component of U3 small nucleolar ribonucleoprotein complex (U3 snoRNP), has been identified as a participant in pre-rRNA processing for nearly twenty years.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB,IHC	Oncotarget; IMP2/IGF2BP2 expression, but not IMP1 and IMP3, predicts poor outcome in patients and high tumor growth rate in xenograft models of gallbladder cancer.; Authors - Sonja M Kessler