IMPA1 Polyclonal antibody

• 

  WB analysis of human kidney using 16593-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 16593-1-AP (IMPA1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 16593-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16593-1-AP (IMPA1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 16593-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 16593-1-AP (IMPA1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 16593-1-AP

  Immunofluorescent analysis of HepG2 cells, using IMPA1 antibody 16593-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

IMPA1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 16593-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

D-galactose 1-phosphate phosphatase, EC:3.1.3.25, EC:3.1.3.94, IMP 1, IMP1

---

Tested Applications

• Positive WB detected in: rat kidney tissue, human kidney tissue, human brain tissue, mouse kidney tissue
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16593-1-AP targets IMPA1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9632

  Product name: Recombinant human IMPA1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-277 aa of BC008381

  Sequence: MADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDED

• Full Name: inositol(myo)-1(or 4)-monophosphatase 1
• Calculated Molecular Weight: 277 aa, 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC008381
• Gene Symbol: IMPA1
• Gene ID (NCBI): 3612
• RRID: AB_2127216
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P29218
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IMPA1 is an enzyme that dephosphorylates myo-inositol monophosphate to generate free myo-inositol, a precursor of phosphatidylinositol, and is therefore an important modulator of intracellular signal transduction via the production of the second messengers myoinositol 1,4,5-trisphosphate and diacylglycerol.