IMPA2 Polyclonal antibody

• 

IMPA2 Polyclonal Antibody for ELISA

Cat No. 15925-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

IMP 2, IMP.18P, IMPA2, IMPase 2, Inositol monophosphatase 2

---

Product Information

15925-1-AP targets IMPA2 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8755

  Product name: Recombinant human IMPA2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-288 aa of BC017176

  Sequence: MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINYGRDDEK

• Full Name: inositol(myo)-1(or 4)-monophosphatase 2
• Calculated Molecular Weight: 288 aa, 31 kDa
• GenBank Accession Number: BC017176
• Gene Symbol: IMPA2
• Gene ID (NCBI): 3613
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14732
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.