• Featured Product
  • KD/KO Validated

IMPDH1 Polyclonal antibody

IMPDH1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 22092-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

IMPDH-I, IMPDH 1, IMPD1, IMPD 1, IMP dehydrogenase 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, mouse spleen tissue, A431 cells, K-562 cells, Raji cells, rat spleen tissue
Positive IP detected inHeLa cells
Positive IHC detected inhuman tonsillitis tissue, human ovary tumor tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:800-1:3200
Immunofluorescence (IF)/ICCIF/ICC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22092-1-AP targets IMPDH1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag17297

Product name: Recombinant human IMPDH1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 170-235 aa of BC033622

Sequence: LSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIELV

Predict reactive species
Full Name IMP (inosine monophosphate) dehydrogenase 1
Calculated Molecular Weight 563 aa, 60 kDa
Observed Molecular Weight 53-60 kDa
GenBank Accession NumberBC033622
Gene Symbol IMPDH1
Gene ID (NCBI) 3614
RRIDAB_2878992
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP20839
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IMPDH1(Inosine-5'-monophosphate dehydrogenase 1) is also named as IMPD1, IMP dehydrogenase 1 and belongs to the IMPDH/GMPR family. It catalyzes the rate limiting step of de novo guanine synthesis and an important target for the development of drugs with both chemotherapeutic and immunosuppressive activity. It may also have a role in the development of malignancy and the growth progression of some tumors. This protein has some isoforms produced by alternative splicing with the molecular mass of 53-65 kDa. This antibody may has cross reaction with IMPDH2 due to their high homology.

Protocols

Product Specific Protocols
IF protocol for IMPDH1 antibody 22092-1-APDownload protocol
IHC protocol for IMPDH1 antibody 22092-1-APDownload protocol
IP protocol for IMPDH1 antibody 22092-1-APDownload protocol
WB protocol for IMPDH1 antibody 22092-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Mol Cell

ERK2 Phosphorylates PFAS to Mediate Posttranslational Control of De Novo Purine Synthesis.

Authors - Eunus S Ali
humanWB,IHC,IF,IP

Mol Ther

IMPDH1/YB-1 Positive Feedback Loop Assembles Cytoophidia and Represents a Therapeutic Target in Metastatic Tumors.

Authors - Hailong Ruan
  • KD Validated
humanWB

J Oncol

The Role of Purine Metabolism-Related Genes PPAT and IMPDH1 in the Carcinogenesis of Intrahepatic Cholangiocarcinoma Based on Metabonomic and Bioinformatic Analyses

Authors - Chang-Jun Liu
  • KD Validated
humanWB

Cells

Distinct Classes of Flavonoids and Epigallocatechin Gallate, Polyphenol Affects an Oncogenic Mutant p53 Protein, Cell Growth and Invasion in a TNBC Breast Cancer Cell Line.

Authors - Madhu Kollareddy
humanWB

Int J Biochem Cell Biol

Characterisation of inosine monophosphate dehydrogenase expression during retinal development: differences between variants and isoforms.

Authors - Gunter Jennifer H JH
humanWB

Clin Chem Lab Med

Reference standards for the detection of anti-mitochondrial and anti-rods/rings autoantibodies.

Authors - S John Calise

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Alexios (Verified Customer) (09-17-2025)

Immunofluorescence staining of iPSCs with IMPDH2 antibody showed a robust signal present in nearly all cells at 60× magnification, perinuclear. The distribution appeared consistent across the culture and aligned with patterns observed in other tested cell lines, supporting the specificity of the antibody signal.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:300
  • Cell Tissue Type: ipsc cells
IMPDH1 Antibody Immunofluorescence validation (1:300 dilution) in ipsc cells (Cat no:22092-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...