IMPDH1 Recombinant monoclonal antibody, PBS Only (Capture)

IMPDH1 Uni-rAb® Recombinant Antibody for WB, Sandwich ELISA, Indirect ELISA
Cat No. 84913-1-PBS
Clone No.242329D8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Sandwich ELISA, Indirect ELISA

242329D8, EC:1.1.1.205, IMP dehydrogenase 1, IMPD 1, IMPD1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84913-1-PBS targets IMPDH1 as part of a matched antibody pair:

MP01726-1: 84913-1-PBS capture and 84913-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag17473

Product name: Recombinant human IMPDH1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 170-235 aa of BC033622

Sequence: LSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIELV

Predict reactive species
Full Name IMP (inosine monophosphate) dehydrogenase 1
Calculated Molecular Weight 563 aa, 60 kDa
Observed Molecular Weight53-60 kDa
GenBank Accession NumberBC033622
Gene Symbol IMPDH1
Gene ID (NCBI) 3614
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP20839
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

IMPDH1(Inosine-5'-monophosphate dehydrogenase 1) is also named as IMPD1, IMP dehydrogenase 1 and belongs to the IMPDH/GMPR family. It catalyzes the rate limiting step of de novo guanine synthesis and an important target for the development of drugs with both chemotherapeutic and immunosuppressive activity. It may also have a role in the development of malignancy and the growth progression of some tumors. This protein has some isoforms produced by alternative splicing with the molecular mass of 53-65 kDa.

Loading...
||
New chat

Able

正在加载,请稍候...