IMPG1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• IMPG1 Polyclonal antibody (19895-1-AP)

IMPG1 Polyclonal Antibody for IHC, ELISA

Cat No. 19895-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF, ELISA

Synonyms

GP147, IMPG1, IPM 150, IPM150, SPACR

• 

  IHC staining of mouse eye using 19895-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse eye tissue slide using 19895-1-AP (IMPG1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse eye using 19895-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse eye tissue slide using 19895-1-AP (IMPG1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for IMPG1 in ?

Chat with Able

---

Tested Applications

• Positive IHC detected in: mouse eye tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

19895-1-AP targets IMPG1 in IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13786

  Product name: Recombinant human IMPG1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 448-797 aa of BC117450

  Sequence: PPFFMASSIFSLTDQGTTDTMATDQTMLVPGLTIPTSDYSAISQLALGISHPPASSDDSRSSAGGEDMVRDLDEMDLSDTPAPSEVPELSEYVSVPDHFLEDTTPVSALQYITTSSMTIAPKGRELVVFFSLRVANMAFSNDLFNKSSLEYRALEQQFTQLLVPYLRSNLTGFKQLEILNFRNGSVIVNSKMKFAKSVPYNLTKAVHGVLEDFRSAAAQQLHLEIDSYSLNIEPADQADPCKFLACGEFAQCVKNEWTEEAECRCKPGYDSQGSLDGLEPGLCGPGTKECEVLQGKGAPCRLPDHSENQAYKTSVKKFQNQQNNKVISKRNSELLTVEYEEFNHQDWEGN

• Full Name: interphotoreceptor matrix proteoglycan 1
• Calculated Molecular Weight: 797 aa, 89 kDa
• GenBank Accession Number: BC117450
• Gene Symbol: IMPG1
• Gene ID (NCBI): 3617
• RRID: AB_2878619
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q17R60
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The IMPG1 Polyclonal antibody (Cat# 19895-1-AP) has 1 total citation. It appears in Experimental Eye Research (IF 3.1), published in 2026. The cited study investigated retinal dysplasia caused by deletion of versican V0/V2 isoforms in mice, using the antibody for immunofluorescence (IF) in mouse tissue. The research field encompasses ophthalmology and ocular developmental biology, specifically retinal structure and extracellular matrix biology.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Exp Eye Res; Deletion of versican V0/V2 isoforms in mice leads to retinal dysplasia.; Authors - Anja K Hoffmann