IMPG1 Polyclonal antibody

• 

  IHC staining of mouse eye using 19895-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse eye tissue slide using 19895-1-AP (IMPG1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse eye using 19895-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse eye tissue slide using 19895-1-AP (IMPG1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

IMPG1 Polyclonal Antibody for IHC, ELISA

Cat No. 19895-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, ELISA

Synonyms

GP147, IMPG1, IPM 150, IPM150, SPACR

---

Tested Applications

• Positive IHC detected in: mouse eye tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

19895-1-AP targets IMPG1 in IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13786

  Product name: Recombinant human IMPG1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 448-797 aa of BC117450

  Sequence: PPFFMASSIFSLTDQGTTDTMATDQTMLVPGLTIPTSDYSAISQLALGISHPPASSDDSRSSAGGEDMVRDLDEMDLSDTPAPSEVPELSEYVSVPDHFLEDTTPVSALQYITTSSMTIAPKGRELVVFFSLRVANMAFSNDLFNKSSLEYRALEQQFTQLLVPYLRSNLTGFKQLEILNFRNGSVIVNSKMKFAKSVPYNLTKAVHGVLEDFRSAAAQQLHLEIDSYSLNIEPADQADPCKFLACGEFAQCVKNEWTEEAECRCKPGYDSQGSLDGLEPGLCGPGTKECEVLQGKGAPCRLPDHSENQAYKTSVKKFQNQQNNKVISKRNSELLTVEYEEFNHQDWEGN

• Full Name: interphotoreceptor matrix proteoglycan 1
• Calculated Molecular Weight: 797 aa, 89 kDa
• GenBank Accession Number: BC117450
• Gene Symbol: IMPG1
• Gene ID (NCBI): 3617
• RRID: AB_2878619
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q17R60
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.