IMUP Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• IMUP Polyclonal antibody, PBS Only (25561-1-PBS)

• 

  WB analysis of A549 using 25561-1-AP (same clone as 25561-1-PBS)

  WB result of IMUP antibody (25561-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-IMUP transfected A549 cells. This data was developed using the same antibody clone with 25561-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 25561-1-AP (same clone as 25561-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25561-1-AP (IMUP antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25561-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SGC-7901 using 25561-1-AP (same clone as 25561-1-PBS)

  SGC-7901 cells were subjected to SDS PAGE followed by western blot with 25561-1-AP (C19orf33 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25561-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

IMUP Polyclonal Antibody for WB, Indirect ELISA

Cat No. 25561-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

25561-1-PBS targets IMUP in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22218

  Product name: Recombinant human C19orf33 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-85 aa of BC060319

  Sequence: MEFDLGAALEPTSQKPGVGAGHGGDPKLSPHKVQGRSEAGAGPGPKASNFRGLGKGRRLTAAPPSSKDTTALPTPAAAPAIRTRM

• Full Name: chromosome 19 open reading frame 33
• Calculated Molecular Weight: 106 aa, 11 kDa
• Observed Molecular Weight: 20 kDa, 22 kDa
• GenBank Accession Number: BC060319
• Gene Symbol: IMUP
• Gene ID (NCBI): 64073
• RRID: AB_3669485
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9GZP8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Immortalization up-regulated protein (IMUP), also known as C19orf33 or H2RSP, was first identified in SV40-immortalized fibroblasts and includes two isoforms, IMUP-1 and IMUP-2 (PMID: 14981917; 35142956). It is found primarily in the nucleus (PMID: 11606055). IMUP is reportedly upregulated in many cancer cells and tissues and its overexpression is associated with tumorigenicity and cell-cycle acceleration (PMID: 16962562; 35142956; 22886722). This polyclonal antibody raised against 1-106 aa of human IMUP can recognize both IMUP-1 and IMUP-2. The apparent molecular determined by SDS-PAGE might be due to post-translational modifications or anomalous migration behavior (PMID: 11080599).