IMUP Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84148-7-RR (same clone as 84148-7-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84148-7-RR (IMUP antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84148-7-PBS in a different storage buffer formulation.

• 

  FC experiment of A431 using 84148-7-RR (same clone as 84148-7-PBS)

  1x10^6 A431 cells were intracellularly stained with 0.25 ug IMUP Recombinant antibody (84148-7-RR, Clone:241220A4) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with True-Nuclear Transcription Factor Buffer Set. This data was developed using the same antibody clone with 84148-7-PBS in a different storage buffer formulation.

• 

  FC experiment of PC-3 using 84148-7-RR (same clone as 84148-7-PBS)

  1x10^6 PC-3 cells were intracellularly stained with 0.25 ug IMUP Recombinant antibody (84148-7-RR, Clone:241220A4) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with True-Nuclear Transcription Factor Buffer Set. This data was developed using the same antibody clone with 84148-7-PBS in a different storage buffer formulation.

IMUP Uni-rAb^® Recombinant Antibody for WB, FC (Intra), Indirect ELISA

Cat No. 84148-7-PBS

Clone No.241220A4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), Indirect ELISA

Synonyms

241220A4, C19orf33, H2RSP, HAI-2-related small protein, Hepatocyte growth factor activator inhibitor type 2-related small protein

---

Product Information

84148-7-PBS targets IMUP in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag22218

  Product name: Recombinant human C19orf33 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-85 aa of BC060319

  Sequence: MEFDLGAALEPTSQKPGVGAGHGGDPKLSPHKVQGRSEAGAGPGPKASNFRGLGKGRRLTAAPPSSKDTTALPTPAAAPAIRTRM

• Full Name: chromosome 19 open reading frame 33
• Calculated Molecular Weight: 106 aa, 11 kDa
• Observed Molecular Weight: 20-22 kDa
• GenBank Accession Number: BC060319
• Gene Symbol: IMUP
• Gene ID (NCBI): 64073
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9GZP8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Immortalization up-regulated protein (IMUP), also known as C19orf33 or H2RSP, was first identified in SV40-immortalized fibroblasts and includes two isoforms, IMUP-1 and IMUP-2 (PMID: 14981917; 35142956). It is found primarily in the nucleus (PMID: 11606055). IMUP is reportedly upregulated in many cancer cells and tissues and its overexpression is associated with tumorigenicity and cell-cycle acceleration (PMID: 16962562; 35142956; 22886722). The apparent molecular determined by SDS-PAGE might be due to post-translational modifications or anomalous migration behavior (PMID: 11080599).