INCA1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• INCA1 Polyclonal antibody, PBS Only (30441-1-PBS)

• 

  WB analysis using 30441-1-AP (same clone as 30441-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30441-1-AP (INCA1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30441-1-PBS in a different storage buffer formulation.

INCA1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 30441-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

30441-1-PBS targets INCA1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27997

  Product name: Recombinant human INCA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 87-236 aa of BC119781

  Sequence: MLWRRKKRRPCLEGMQQQGLGGVPARVRAVTYHLEDLRRRQSIINELKKAQWGSSGAASEPVVLGEEGCGFPSTNEYPDLEEERATYPQEEDRFLTPGRAQLLWSPWSPLDQEEACASRQLHSLASFSTVTARRNPLHNPWGMELAASEE

• Full Name: inhibitor of CDK interacting with cyclin A1
• Calculated Molecular Weight: 236 aa, 27 kDa
• Observed Molecular Weight: 26-30 kDa
• GenBank Accession Number: BC119781
• Gene Symbol: INCA1
• Gene ID (NCBI): 388324
• RRID: AB_3086316
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q0VD86
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.