Inhibin Alpha Polyclonal antibody

• 

Inhibin alpha Polyclonal Antibody for IHC, ELISA

Cat No. 10609-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF, IHC, ELISA

Synonyms

INHA, Inhibin alpha, Inhibin alpha chain, inhibin, alpha

---

Published Applications

• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

10609-1-AP targets Inhibin alpha in IF, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0922

  Product name: Recombinant human INHA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-366 aa of BC006391

  Sequence: MVLHLLLFLLLTPQGGHSCQGLELARELVLAKVRALFLDALGPPAVTREGGDPGVRRLPRRHALGGFTHRGSEPEEEEDVSQAILFPATDASCEDKSAARGLAQEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEPLLGLLALSPGGPVAVPMSLGHAPPHWAVLHLATSALSLLTHPVLVLLLRCPLCTCSARPEATPFLVAHTRTRPPSGGERARRSTPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIPPNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLTQHCACI

• Full Name: inhibin, alpha
• Calculated Molecular Weight: 40 kDa
• GenBank Accession Number: BC006391
• Gene Symbol: Inhibin alpha
• Gene ID (NCBI): 3623
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P05111
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Oncogene; USP13 promotes development and metastasis of high-grade serous ovarian carcinoma in a novel mouse model.; Authors - Juntae Kwon
human	IF	J Biol Chem; Integrin αvβ3-associated DAAM1 is essential for collagen-induced invadopodia extension and cell haptotaxis in breast cancer cells.; Authors - Ting Yan