INMT Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• INMT Polyclonal antibody, PBS Only (21578-1-PBS)

• 

  WB analysis of mouse pancreas using 21578-1-AP (same clone as 21578-1-PBS)

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 21578-1-AP (INMT antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21578-1-PBS in a different storage buffer formulation.

INMT Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21578-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

21578-1-PBS targets INMT in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16121

  Product name: Recombinant human INMT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 67-263 aa of BC106903

  Sequence: TIYQVLAACDSFQDITLSDFTDRNREELEKWLKKEPGAYDWTPAVKFACELEGNSGRWEEKEEKLRAAVKRVLKCDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAALCNLASLLKPGGHLVTTVTLRLPSYVVGKREFSCVALEKEEVEQAVLDAGFDIEQLLHSPQSYSVTNAANNGVCCIVARKKPGP

• Full Name: indolethylamine N-methyltransferase
• Calculated Molecular Weight: 263 aa, 29 kDa
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC106903
• Gene Symbol: INMT
• Gene ID (NCBI): 11185
• RRID: AB_10733240
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95050
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.