INPP4A Polyclonal antibody

• 

  WB analysis using 12665-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12665-1-AP (INPP4A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 12665-1-AP

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 12665-1-AP (INPP4A antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A549 using 12665-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using INPP4A antibody (12665-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red).

INPP4A Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 12665-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Type I inositol 3,4-bisphosphate 4-phosphatase, INPP4, INP4A, Inositol polyphosphate-4-phosphatase type I A, Inositol polyphosphate 4-phosphatase type I

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12665-1-AP targets INPP4A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3346

  Product name: Recombinant human INPP4A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-301 aa of BC028361

  Sequence: MTAREHSPRHGARARAMQRASTIDVAADMLGLSLAGNIQDPDEPILEFSLACSELHTPSLDRKPNSFVAVSVTTPPQAFWTKHAQTEIIEGTNNPIFLSSIAFFQDSLINQMTQVKLSVYDVKDRSQGTMYLLGSGTFIVKDLLQDRHHRLHLTLRSAESDRVGNITVIGWQMEEKSDQRPPVTRSVDTVNGRMVLPVDESLTEALGIRSKYASLRKDTLLKSVFGGAICRMYRFPTTDGNHLRILEQMAESVLSLHVPRQFVKLLLEEDAARVCELEELGELSPCWESLRRQIVTQYQTI

• Full Name: inositol polyphosphate-4-phosphatase, type I, 107kDa
• Calculated Molecular Weight: 972 aa, 109 kDa
• Observed Molecular Weight: 100-110 kDa
• GenBank Accession Number: BC028361
• Gene Symbol: INPP4A
• Gene ID (NCBI): 3631
• RRID: AB_3669147
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96PE3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Inositol polyphosphate 4 phosphatase (INPP4A) belongs to the group of phosphoinositide phosphatases controlling proliferation, apoptosis, and endosome function by hydrolyzing phosphatidylinositol 3,4-bisphosphate. INPP4A is highly expressed in the central nervous system, which is shown to play a key role in glutamate excitotoxicity and cell proliferation. (PMID: 36653678, PMID: 31938306)