INSL4 Polyclonal antibody

• 

INSL4 Polyclonal Antibody for ELISA

Cat No. 11907-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

ELISA

Synonyms

EPIL, INSL4, insulin like 4 (placenta), Insulin like peptide 4, PLACENTIN

---

Product Information

11907-1-AP targets INSL4 in ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2580

  Product name: Recombinant human INSL4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 23-139 aa of BC026254

  Sequence: SLAAELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLESGRPKEMVSTSNNKDGQALGTTSEFIPNLSPELKKPLSEGQPSLKKIILSRKKRSGRHRFDPFCCEVICDDGTSVKLCT

• Full Name: insulin-like 4 (placenta)
• Calculated Molecular Weight: 139 aa, 15 kDa
• GenBank Accession Number: BC026254
• Gene Symbol: INSL4
• Gene ID (NCBI): 3641
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14641
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.