INSM1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• INSM1 Recombinant monoclonal antibody (88423-2-RR)

INSM1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 88423-2-RR Copied!

Clone No. 260971G7

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

IA-1, IA 1, IA1, INSM 1, insulinoma associated 1

• 

  WB analysis of NCI-H146 using 88423-2-RR

  NCI-H146 cells were subjected to SDS PAGE followed by western blot with 88423-2-RR (INSM1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. A-673 cells as negative control.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 88423-2-RR

  Biolayer interferometry (BLI) kinetic assays of 88423-2-RR against Human INSM1 were performed. The affinity constant is 2.16 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for INSM1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: NCI-H146 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

88423-2-RR targets INSM1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag33774

  Product name: Recombinant human INSM1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-230 aa of NM_002196

  Sequence: MPRGFLVKRSKKSTPVSYRVRGGEDGDRALLLSPSCGGARAEPPAPSPVPGPLPPPPPAERAHAALAAALACAPGPQPPPQGPRAAHFGNPEAAHPAPLYSPTRPVSREHEKHKYFERSFNLGSPVSAESFPTPAALLGGGGGGGASGAGGGGTCGGDPLLFAPAELKMGTAFSAGAEAARGPGPGPPLPPAAALRPPGKRPPPPTAAEPPAKAVKAPGAKKPKAIRKLH*

• Full Name: insulinoma-associated 1
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 53-60 kDa
• GenBank Accession Number: NM_002196
• Gene Symbol: INSM1
• Gene ID (NCBI): 3642
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q01101
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Insulinoma-associated-1 (INSM1) is a zinc-finger transcription factor that was originally identified in a human insulinoma subtraction library. INSM1 plays a cardinal role as a transcription factor in the differentiation of embryonic neuroendocrine cells. In situ hybridization studies of human tissues have shown the presence of the INSM1 transcript across various brain regions, as well as in endocrine organs such as the pancreas, adrenal gland, thymus, thyroid, and the endocrine cells of the gastrointestinal tract .(PMID: 34943408, PMID: 36290282)