INTS3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• INTS3 Polyclonal antibody (16620-1-AP)

• Featured Product
• KD/KO Validated

INTS3 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 16620-1-AP Copied!

Publications (16)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ChIP, ELISA

Synonyms

C1orf193, C1orf60, Int3, Integrator complex subunit 3, Sensor of single-strand DNA complex subunit A

• 

  WB analysis of HEK-293 using 16620-1-AP

  WB result of INTS3 antibody (16620-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-INTS3 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 16620-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16620-1-AP (INTS3 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HEK-293 using 16620-1-AP

  IP result of anti-INTS3 (IP:16620-1-AP, 4ug; Detection:16620-1-AP 1:1000) with HEK-293 cells lysate 1360 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 16620-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 16620-1-AP (INTS3 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for INTS3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, mouse testis tissue, rat testis tissue
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16620-1-AP targets INTS3 in WB, IHC, IF, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9917

  Product name: Recombinant human INTS3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 91-445 aa of BC025254

  Sequence: YHLLYYLRASKAAAGKMNLYESFAQATQLGDLHTCLMMDMKACQEDDVRLLCHLTPSIYTEFPDETLRSGELLNMIVAVIDSAQLQELVCHVMMGNLVMFRKDSVLNILIQSLDWETFEQYCAWQLFLAHNIPLETIIPILQHLKYKEHPEALSCLLLQLRREKPSEEMVKMVLSRPCHPDDQFTTSILRHWCMKHDELLAEHIKSLLIKNNSLPRKRQSLRSSSSKLAQLTLEQILEHLDNLRLNLTNTKQNFFSQTPILQALQHVQASCDEAHKMKFSDLFSLAEEYEDSSTKPPKSRRKAALSSPRSRKNATQPPNAEEESGSSSASEEEDTKPKPTKRKRKGSSAVGSDSD

• Full Name: integrator complex subunit 3
• Calculated Molecular Weight: 118 kDa
• Observed Molecular Weight: 118 kDa
• GenBank Accession Number: BC025254
• Gene Symbol: INTS3
• Gene ID (NCBI): 65123
• RRID: AB_2127274
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q68E01
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

INTS3 is a member of the integrator complex characterised as an RNA polymerase II (RNAPII) C-terminal domain binding factor involved in the processing of small nuclear RNAs (snRNAs) (PMID: 16239144). INTS3 was overexpressed in colorectal cancer (CRC) patients and tumour cell lines and inhibited CRC apoptosis by promoting the degradation of pro-apoptotic gene transcripts (PMID: 38665208).

Publications

What published studies show

The INTS3 Polyclonal antibody (catalog no. 16620-1-AP) has 16 citations. They appear in high-impact journals including Science, Cell, Nature Communications, Molecular Cell, PNAS, Genome Biology, Cell Reports, EMBO Reports, iScience, MicroPubl Biol, and Apoptosis. Research fields span RNA polymerase II transcription regulation, the Integrator complex, cancer, ciliopathy, DNA damage repair, and viral infection.

Automatically generated from the 16 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Science; Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.; Authors - Hai Zheng
human	WB	Cell; The PP2A-Integrator-CDK9 axis fine-tunes transcription and can be targeted therapeutically in cancer.; Authors - Stephin J Vervoort
human	WB	Nat Commun; INTS13 variants causing a recessive developmental ciliopathy disrupt assembly of the Integrator complex; Authors - Lauren G. Mascibroda
human	WB,IP,ChIP	Nat Commun; DSS1 is required for proper Integrator-PP2A function; Authors - Congling Xu
human	ChIP, WB	Nat Commun; Integrator complex regulates NELF-mediated RNA polymerase II pause/release and processivity at coding genes.; Authors - Bernd Stadelmayer
human	WB	Mol Cell; Integrator Recruits Protein Phosphatase 2A to Prevent Pause Release and Facilitate Transcription Termination.; Authors - Kai-Lieh Huang