INTS3 Monoclonal antibody, PBS Only

• 

  WB analysis using 67060-1-Ig (same clone as 67060-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67060-1-Ig (INTS3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Lamin B1 Monoclonal antibody (HRP-66095) as loading control. This data was developed using the same antibody clone with 67060-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 67060-1-Ig (same clone as 67060-1-PBS)

  WB result of INTS3 antibody (67060-1-Ig; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-INTS3 transfected HEK-293 cells. This data was developed using the same antibody clone with 67060-1-PBS in a different storage buffer formulation.

• 

  WB analysis of 4T1 using 67060-1-Ig (same clone as 67060-1-PBS)

  4T1 cells were subjected to SDS PAGE followed by western blot with 67060-1-Ig (INTS3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67060-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 67060-1-Ig (same clone as 67060-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using INTS3 antibody (67060-1-Ig, Clone: 2G11B7 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-phalloidin (red). This data was developed using the same antibody clone with 67060-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

INTS3 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 67060-1-PBS

Clone No.2G11B7

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

2G11B7, C1orf193, C1orf60, Int3, Integrator complex subunit 3

---

Product Information

67060-1-PBS targets INTS3 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9917

  Product name: Recombinant human INTS3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 91-445 aa of BC025254

  Sequence: YHLLYYLRASKAAAGKMNLYESFAQATQLGDLHTCLMMDMKACQEDDVRLLCHLTPSIYTEFPDETLRSGELLNMIVAVIDSAQLQELVCHVMMGNLVMFRKDSVLNILIQSLDWETFEQYCAWQLFLAHNIPLETIIPILQHLKYKEHPEALSCLLLQLRREKPSEEMVKMVLSRPCHPDDQFTTSILRHWCMKHDELLAEHIKSLLIKNNSLPRKRQSLRSSSSKLAQLTLEQILEHLDNLRLNLTNTKQNFFSQTPILQALQHVQASCDEAHKMKFSDLFSLAEEYEDSSTKPPKSRRKAALSSPRSRKNATQPPNAEEESGSSSASEEEDTKPKPTKRKRKGSSAVGSDSD

• Full Name: integrator complex subunit 3
• Calculated Molecular Weight: 118 kDa
• Observed Molecular Weight: 118 kDa
• GenBank Accession Number: BC025254
• Gene Symbol: INTS3
• Gene ID (NCBI): 65123
• RRID: AB_2882370
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q68E01
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.