INTS6 Recombinant monoclonal antibody

• 

  WB analysis using 84610-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84610-1-RR (INTS6 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 84610-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using INTS6 antibody (84610-1-RR, Clone: 242099C7 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  IF Staining of HeLa using 84610-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using INTS6 antibody (84610-1-RR, Clone: 242099C7 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  Affinity and Kinetic Characterization of 84610-1-RR

  Biolayer interferometry (BLl) kinetic assays of 84610-1-RR against Human INTS6 were performed. The affinity constant is 0.63 nM.

INTS6 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 84610-1-RR

Clone No.242099C7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

242099C7, DBI 1, DBI1, DDX26, DDX26A

---

Tested Applications

• Positive WB detected in: PC-3 cells, DU 145 cells, HuH-7 cells, MCF-7 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84610-1-RR targets INTS6 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag36146

  Product name: Recombinant human INTS6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 672-815 aa of BC039829

  Sequence: VVNNHIGGKGPPAPTTQAQPDLIKPLPLHKISETTNDSIIHDVVENHVADQLSSDITPNAMDTEFSASSPASLLERPTNHMEALGHDHLGTNDLTVGGFLENHEEPRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQ

• Full Name: integrator complex subunit 6
• Calculated Molecular Weight: 100 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: BC039829
• Gene Symbol: INTS6
• Gene ID (NCBI): 26512
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UL03
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

INTS6 is a component of the Integrator (INT) complex, a complex involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing.