Product Information
84382-2-PBS targets INTS8 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag34627 Product name: Recombinant human INTS8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 896-995 aa of BC136754 Sequence: QVAILCQFLREIDYKTAFKSLQEQNSHDAMDSYYDYIWDVTILEYLTYLHHKRGETDKRQIAIKAIGQTELNASNPEEVLQLAAQRRKKKFLQAMAKLYF Predict reactive species |
| Full Name | integrator complex subunit 8 |
| Calculated Molecular Weight | 111 kDa |
| Observed Molecular Weight | 111 kDa |
| GenBank Accession Number | BC136754 |
| Gene Symbol | INTS8 |
| Gene ID (NCBI) | 55656 |
| RRID | AB_3743550 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q75QN2 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Integrator complex subunit 8 (INTS8) is one of the major components of RNA polymerase II and has been demonstrated to be involved in the cleavage of small nuclear RNAs and transcriptional processes (PMID: 34880328). INTS8 was robustly increased in neurodevelopmental diseases and numerous tumors. High INTS8 expression has a tight correlation with poor prognosis in multi-cancers (PMID: 30881114). Western blot analysis detected INTS8 at an apparent molecular mass of 111 kDa.

