INTS8 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• INTS8 Recombinant monoclonal antibody, PBS Only (84382-2-PBS)

INTS8 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84382-2-PBS

Clone No.253187D5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

C8orf52, Int8, Integrator complex subunit 8, Protein kaonashi 1, Protein kaonashi-1

• 

  WB analysis using 84382-2-RR (same clone as 84382-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84382-2-RR (INTS8 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84382-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

84382-2-PBS targets INTS8 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34627

  Product name: Recombinant human INTS8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 896-995 aa of BC136754

  Sequence: QVAILCQFLREIDYKTAFKSLQEQNSHDAMDSYYDYIWDVTILEYLTYLHHKRGETDKRQIAIKAIGQTELNASNPEEVLQLAAQRRKKKFLQAMAKLYF

• Full Name: integrator complex subunit 8
• Calculated Molecular Weight: 111 kDa
• Observed Molecular Weight: 111 kDa
• GenBank Accession Number: BC136754
• Gene Symbol: INTS8
• Gene ID (NCBI): 55656
• RRID: AB_3743550
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q75QN2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Integrator complex subunit 8 (INTS8) is one of the major components of RNA polymerase II and has been demonstrated to be involved in the cleavage of small nuclear RNAs and transcriptional processes (PMID: 34880328). INTS8 was robustly increased in neurodevelopmental diseases and numerous tumors. High INTS8 expression has a tight correlation with poor prognosis in multi-cancers (PMID: 30881114). Western blot analysis detected INTS8 at an apparent molecular mass of 111 kDa.