INTS9 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• INTS9 Polyclonal antibody (11657-1-AP)

INTS9 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 11657-1-AP Copied!

Publications (7)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, ELISA

Synonyms

CPSF, CPSF2, CPSF2L, Int9, INTS 9

• 

  WB analysis using 11657-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11657-1-AP (INTS9 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 11657-1-AP

  IP result of anti-INTS9 (IP:11657-1-AP, 4ug; Detection:11657-1-AP 1:1000) with HeLa cells lysate 1280 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 11657-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 11657-1-AP (INTS9 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for INTS9 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, Jurkat cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11657-1-AP targets INTS9 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2226

  Product name: Recombinant human INTS9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 309-658 aa of BC025267

  Sequence: LECLYQYIDSAGLSSVPLYFISPVANSSLEFSQIFAEWLCHNKQSKVYLPEPPFPHAELIQTNKLKHYPSIHGDFSNDFRQPCVVFTGHPSLRFGDVVHFMELWGKSSLNTVIFTEPDFSYLEALAPYQPLAMKCIYCPIDTRLNFIQVSKLLKEVQPLHVVCPEQYTQPPPAQSHRMDLMIDCQPPAMSYRRAEVLALPFKRRYEKIEIMPELADSLVPMEIKPGISLATVSAVLHTKDNKHLLQPPPRPAQPTSGKKRKRVSDDVPDCKVLKPLLSGSIPVEQFVQTLEKHGFSDIKVEDTAKGHIVLLQEAETLIQIEEDSTHIICDNDEMLRVRLRDLVLKFLQKF

• Full Name: integrator complex subunit 9
• Calculated Molecular Weight: 658 aa, 74 kDa
• Observed Molecular Weight: 74 kDa
• GenBank Accession Number: BC025267
• Gene Symbol: INTS9
• Gene ID (NCBI): 55756
• RRID: AB_2127514
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NV88
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

INTS9, also known as Integrator Complex Subunit 9, is part of the core cleavage module consisting of INTS4/INTS9/INTS11 involved in processing small nuclear RNA (snRNA) molecules. It is a subunit of the Integrator complex, which comprises 15 subunits (including INTS6L), and plays a crucial role in the 3' end processing of snRNAs. By participating in the biogenesis of snRNAs, INTS9 contributes to the proper functioning of the spliceosome, a cellular machinery responsible for the accurate splicing of precursor messenger RNA (pre-mRNA) molecules. This process is essential for generating mature messenger RNA (mRNA), which is subsequently translated into functional proteins.

Publications

What published studies show

The anti-INTS11 antibody (Cat# 11657-1-AP) has 7 total citations published in Nature, Nature Communications, Molecular Cell (×3), Protein Expression and Purification, and eLife. The research fields span RNA biology, Integrator complex structure and function, transcription–replication conflict resolution, genome stability, and promoter directionality. Applications cited include Western blot and immunoprecipitation in human samples.

Automatically generated from the 7 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Nature; CFAP20 salvages arrested RNAPII from the path of co-directional replisomes; Authors - Sidrit Uruci
human	WB	Nat Commun; INTS10-INTS13-INTS14 form a functional module of Integrator that binds nucleic acids and the cleavage module.; Authors - Kevin Sabath
human	WB	Mol Cell; Assembly mechanism of Integrator's RNA cleavage module; Authors - Kevin Sabath
human	WB,IP	Mol Cell; Integrator facilitates RNAPII removal to prevent transcription-replication collisions and genome instability; Authors - Rahul Bhowmick
human	WB,IP	Mol Cell; Cytoplasmic binding partners of the Integrator endonuclease INTS11 and its paralog CPSF73 are required for their nuclear function; Authors - Min-Han Lin
human	WB	Protein Expr Purif; CRISPR-Cas9 mediated genetic engineering for the purification of the endogenous integrator complex from mammalian cells.; Authors - David Baillat