INTU Polyclonal antibody

• 

  WB analysis of mouse liver using 24914-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 24914-1-AP (INTU Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 24914-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 24914-1-AP (INTU Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 24914-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 24914-1-AP (INTU Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

INTU Polyclonal Antibody for WB, ELISA

Cat No. 24914-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

INT, INTU, KIAA1284, PDZD6, PDZK6

---

Tested Applications

• Positive WB detected in: mouse liver tissue, mouse heart tissue, mouse skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24914-1-AP targets INTU in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19313

  Product name: Recombinant human INTU protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-354 aa of BC130611

  Sequence: MASVASCDSRPSSDELPGDPSSQEEDEDYDFEDRVSDSGSYSSASSDYDDLEPEWLDSVQKNGELFYLELSEDEEESLLPETPTVNHVRFSENEIIIEDDYKERKKYEPKLKQFTKILRRKRLLPKRCNKKNSNDNGPVSILKHQSNQKTGVIVQQRYKDVNVYVNPKKLTVIKAKEQLKLLEVLVGIIHQTKWSWRRTGKQGDGERLVVHGLLPGGSAMKSGQVLIGDVLVAVNDVDVTTENIERVLSCIPGPMQVKLTFENAYDVKRETSHPRQKKTQSNTSDLVKLLWGEEVEGIQQSGLNTPHIIMYLTLQLDSETSKEEQEILYHYPMSEASQKLKSVRGIFLTLCDML

• Full Name: inturned planar cell polarity effector homolog (Drosophila)
• Calculated Molecular Weight: 942 aa, 106 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC130611
• Gene Symbol: INTU
• Gene ID (NCBI): 27152
• RRID: AB_2879794
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9ULD6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

INTU also named as KIAA1284, PDZD6, and PDZK6 is a 942 amino-acid protein, which belongs to the inturned family. INTU contains a PDZ domain and localizes in cytoplasm. Intu, a tissue-specific PCP effector gene, play a role in the context of skin and hair follicle development. Intu is expressed in both epidermal and dermal cells of the skin.