IPCEF1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• IPCEF1 Polyclonal antibody, PBS Only (33464-1-PBS)

• 

  WB analysis using 33464-1-AP (same clone as 33464-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33464-1-AP (IPCEF1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33464-1-PBS in a different storage buffer formulation.

IPCEF1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33464-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Interactor protein for cytohesin exchange factors 1, KIAA0403, Phosphoinositide-binding protein PIP3-E

---

Product Information

33464-1-PBS targets IPCEF1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35423

  Product name: Recombinant human IPCEF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 210-437 aa of BC143629

  Sequence: FPSSLSKERQSLPDTVNSLSAAEDEGQPITFAVQVHSPVPSEAGIHKALENSFVTSESGFLNSLSSDDTSSLSSNHDHLTVPDKPAGSKIMDKEETKVSEDDEMEKLYKSLEQASLSPLGDRRPSTKKELRKSFVKRCKNPSINEKLHKIRTLNSTLKCKEHDLAMINQLLDDPKLTARKYREWKVMNTLLIQDIYQQQRASPAPDDTDDTPQELKKSPSSPSVENSI

• Full Name: interaction protein for cytohesin exchange factors 1
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: BC143629
• Gene Symbol: IPCEF1
• Gene ID (NCBI): 26034
• RRID: AB_3742982
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8WWN9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.