IQCC Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• IQCC Polyclonal antibody, PBS Only (21533-1-PBS)

• 

  WB analysis using 21533-1-AP (same clone as 21533-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21533-1-AP (IQCC antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21533-1-PBS in a different storage buffer formulation.

IQCC Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21533-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

21533-1-PBS targets IQCC in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16161

  Product name: Recombinant human IQCC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 117-466 aa of BC098317

  Sequence: CRDHSSWLQMKQNRKPSQEKTRDTTRMENPEATDQRLPHSQPQLQELQYHRSHLAMELLWLQQAINSRKEYLLLKQTLRSPEAGPIREEPRVFLEHGEQACERDQSQPSAPLEDQSYRDRTTGELEQEDDSCHRVKSPHRSPGSLATTQKNIAGAKCREPCYSKSGPPSSIPSNSQALGDRLTKGPDDGRQTFGGTCLLQMKILEDQTPRGLKPRNHCPRKSRTQLSALYEDSNIKEMSPRKLDHKEPDCRTVRTQELGLSEDHIIWDGTLGGPEHSVLDLWRTKPPKGQAPTDRSSRDGTSNEPSHEGQKKQRTIPWRSKSPEILSSTKAGCTGEEQWRGRPWKTEPPG

• Full Name: IQ motif containing C
• Calculated Molecular Weight: 466 aa, 53 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: BC098317
• Gene Symbol: IQCC
• Gene ID (NCBI): 55721
• RRID: AB_3085660
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q4KMZ1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.