IQGAP1 Monoclonal antibody

• 

  WB analysis using 68588-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68588-1-Ig (IQGAP1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human skin cancer using 68588-1-Ig

  Immunohistochemical analysis of paraffin-embedded skin cancer slide using 68588-1-Ig (IQGAP1 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

IQGAP1 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 68588-1-Ig

Clone No.2E11A2

Host / Isotype

Mouse / IgG2a

Reactivity

human, rat

Applications

WB, IHC, ELISA

Synonyms

2E11A2, HUMORFA01, KIAA0051, p195, Ras GTPase-activating-like protein IQGAP1

---

Tested Applications

• Positive WB detected in: A431 cells, A549 cells, LNCaP cells, MCF-7 cells, HeLa cells, HepG2 cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells
• Positive IHC detected in: human skin cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68588-1-Ig targets IQGAP1 in WB, IHC, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19321

  Product name: Recombinant human IQGAP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 478-827 aa of BC151834

  Sequence: QLSSSVTGLTNIEEENCQRYLDELMKLKAQAHAENNEFITWNDIQACVDHVNLVVQEEHERILAIGLINEALDEGDAQKTLQALQIPAAKLEGVLAEVAQHYQDTLIRAKREKAQEIQDESAVLWLDEIQGGIWQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPECGETYHSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEPPNFVQNSMQLSREEIQSSISGVTAAYNREQLWLANEGLITRLQARCRGYLVRQEFRSRMNFLKKQIPAITCIQSQWRGYKQKKAYQDRLAYLRSHKDEVVKIQSLARMHQARKRYRD

• Full Name: IQ motif containing GTPase activating protein 1
• Calculated Molecular Weight: 189 kDa
• Observed Molecular Weight: 190-195 kDa
• GenBank Accession Number: BC151834
• Gene Symbol: IQGAP1
• Gene ID (NCBI): 8826
• ENSEMBL Gene ID: ENSG00000140575
• RRID: AB_3085287
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P46940
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IQGAP1 is a member of a family of scaffolding proteins that interact with signaling and structural molecules. It localizes to sites of cell-cell contact in epithelial cells and regulates distinct cellular processes including cell adhesion, cell migration, extracellular signals through interacting with numerous protein. Multiple studies have shown that IQGAP1 is up-regulated in many human malignancies, such as lung cancer, ovarian cancer, colon cancer, breast cancer, melanoma and HCC. And IQGAP1 plays a critical role in cancer cell invasion.