IQGAP1 Recombinant monoclonal antibody, PBS Only

IQGAP1 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 85651-2-PBS
Clone No.242206A8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

HUMORFA01, KIAA0051, p195, Ras GTPase-activating-like protein IQGAP1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85651-2-PBS targets IQGAP1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag19321

Product name: Recombinant human IQGAP1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 478-827 aa of BC151834

Sequence: QLSSSVTGLTNIEEENCQRYLDELMKLKAQAHAENNEFITWNDIQACVDHVNLVVQEEHERILAIGLINEALDEGDAQKTLQALQIPAAKLEGVLAEVAQHYQDTLIRAKREKAQEIQDESAVLWLDEIQGGIWQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPECGETYHSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEPPNFVQNSMQLSREEIQSSISGVTAAYNREQLWLANEGLITRLQARCRGYLVRQEFRSRMNFLKKQIPAITCIQSQWRGYKQKKAYQDRLAYLRSHKDEVVKIQSLARMHQARKRYRD

Predict reactive species
Full Name IQ motif containing GTPase activating protein 1
Calculated Molecular Weight 189 kDa
Observed Molecular Weight 190-195 kDa
GenBank Accession NumberBC151834
Gene Symbol IQGAP1
Gene ID (NCBI) 8826
ENSEMBL Gene IDENSG00000140575
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP46940
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

IQGAP1 is a member of a family of scaffolding proteins that interact with signaling and structural molecules. It localizes to sites of cell-cell contact in epithelial cells and regulates distinct cellular processes including cell adhesion, cell migration, extracellular signals through interacting with numerous protein. Multiple studies have shown that IQGAP1 is up-regulated in many human malignancies, such as lung cancer, ovarian cancer, colon cancer, breast cancer, melanoma and HCC. And IQGAP1 plays a critical role in cancer cell invasion.

Loading...
||
New chat Able
正在加载,请稍候...