IRAK3 Polyclonal antibody

• 

  WB analysis using 28766-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28766-1-AP (IRAK3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse colon using 28766-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 28766-1-AP (IRAK3 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat small intestine using 28766-1-AP

  Immunohistochemical analysis of paraffin-embedded rat small intestine tissue slide using 28766-1-AP (IRAK3 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

IRAK3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28766-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

IRAK M, IRAK 3, Interleukin-1 receptor-associated kinase 3, Inactive IL-1 receptor-associated kinase 3, IL-1 receptor-associated kinase M

---

Tested Applications

• Positive WB detected in: mouse spleen tissue, rat spleen tissue
• Positive IHC detected in: mouse colon tissue, rat small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below

Product Information

28766-1-AP targets IRAK3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30309

  Product name: Recombinant human IRAK3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 368-500 aa of BC057800

  Sequence: LTGCRVVLDDPKHIQLRDLLRELMEKRGLDSCLSFLDKKVPPCPRNFSAKLFCLAGRCAATRAKLRPSMDEVLNTLESTQASLYFAEDPPTSLKSFRCPSPLFLENVPSIPVEDDESQNNNLLPSDEGLRIDR

• Full Name: interleukin-1 receptor-associated kinase 3
• Calculated Molecular Weight: 68 kDa
• Observed Molecular Weight: 60-65 kDa
• GenBank Accession Number: BC057800
• Gene Symbol: IRAK3
• Gene ID (NCBI): 11213
• RRID: AB_2881211
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y616
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Inflammation; CircIRAK3 Promotes Neutrophil Extracellular Trap Formation by Improving the Stability of ELANE mRNA in Sepsis; Authors - Yao Lu ; KD Validated
mouse	WB	J Orthop Surg Res; Integrated analysis of bioinformatics, mendelian randomization, and experimental validation reveals novel diagnostic and therapeutic targets for osteoarthritis: progesterone as a potential therapeutic agent; Authors - Ziyu Weng