IRAK4 Monoclonal antibody

• 

  WB analysis using 67180-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67180-1-Ig (IRAK4 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse pancreas using 67180-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 67180-1-Ig (IRAK4 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 67180-1-Ig

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 67180-1-Ig (IRAK4 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 67180-1-Ig

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 67180-1-Ig (IRAK4 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 67180-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 67180-1-Ig (IRAK4 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat pancreas using 67180-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat pancreas tissue slide using 67180-1-Ig (IRAK4 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat stomach using 67180-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 67180-1-Ig (IRAK4 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 67180-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using IRAK4 antibody (67180-1-Ig, Clone: 1A4C4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-phalloidin (red).

IRAK4 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67180-1-Ig

Clone No.1A4C4

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

1A4C4, EC:2.7.11.1, Interleukin-1 receptor-associated kinase 4, IPD1, IRAK 4

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells, THP-1 cells, K-562 cells
• Positive IHC detected in: human placenta tissue, mouse kidney tissue, mouse pancreas tissue, rat pancreas tissue, rat stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:3000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67180-1-Ig targets IRAK4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29174

  Product name: Recombinant human IRAK4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-200 aa of BC013316

  Sequence: MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALLQTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITVQQKQMPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVV

• Full Name: interleukin-1 receptor-associated kinase 4
• Calculated Molecular Weight: 52 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC013316
• Gene Symbol: IRAK4
• Gene ID (NCBI): 51135
• RRID: AB_2882476
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NWZ3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.