IRF2BP1 Recombinant monoclonal antibody, PBS Only

IRF2BP1 Uni-rAb® Recombinant Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 86048-1-PBS
Clone No.250630H5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

EC:2.3.2.27, Interferon regulatory factor 2-binding protein 1, IRF 2 binding protein 1, IRF 2BP1, IRF-2-binding protein 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86048-1-PBS targets IRF2BP1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4596

Product name: Recombinant human IRF2BP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 234-584 aa of BC038222

Sequence: LALSACAPFNVRFKKDHGLVGRVFAFDATARPPGYEFELKLFTEYPCGSGNVYAGVLAVARQMFHDALREPGKALASSGFKYLEYERRHGSGEWRQLGELLTDGVRSFREPAPAEALPQQYPEPAPAALCGPPPRAPSRNLAPTPRRRKASPEPEGEAAGKMTTEEQQQRHWVAPGGPYSAETPGVPSPIAALKNVAEALGHSPKDPGGGGGPVRAGGASPAASSTAQPPTQHRLVARNGEAEVSPTAGAEAVSGGGSGTGATPGAPLCCTLCRERLEDTHFVQCPSVPGHKFCFPCSREFIKAQGPAGEVYCPSGDKCPLVGSSVPWAFMQGEIATILAGDIKVKKERDP

Predict reactive species
Full Name interferon regulatory factor 2 binding protein 1
Calculated Molecular Weight 584 aa, 62 kDa
Observed Molecular Weight65-70 kDa
GenBank Accession NumberBC038222
Gene Symbol IRF2BP1
Gene ID (NCBI) 26145
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8IU81
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

IRF2BP1 inhibits IRF2-mediated transcriptional activation by interacting with IRF2. In epidermal growth factor receptor (EGFR) signaling, transient deSUMOylation of IRF2BP1 is essential for the proper expression of immediate early genes such as DUSP1 and ATF3. IRF2BP1 is also involved in the TGF-β signaling pathway by controlling the accumulation of cPML in the cytoplasm, which in turn affects the phosphorylation of Smad2 and the assembly of the Smad2-receptor complex.

Loading...
||
New chat Able
正在加载,请稍候...