IRF9 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA standard curve of MP01881-3

  Sandwich ELISA standard curve of MP01881-3, Human IRF9 Recombinant Matched Antibody Pair - PBS only. 85160-4-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag5365. 85160-5-PBS was HRP conjugated as the detection antibody. Range: 0.391-25 ng/mL

• 

  Sample test of MP01881-3

  The mean IRF9 concentration was determined to be 20.54 ng/mL in A549 cell extract based on a 2.6 mg/mL extract load, 27.43 ng/mL in HeLa cell extract based on a 1.5 mg/mL extract load and 31.22 ng/mL in MCF-7 cell extract based on a 3.5 mg/mL extract load.

IRF9 Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 85160-5-PBS

Clone No.242772A2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

ISGF-3 gamma, IRF-9, IRF 9, Interferon-stimulated gene factor 3 gamma, IFN-alpha-responsive transcription factor subunit

---

Product Information

85160-5-PBS targets IRF9 as part of a matched antibody pair:

MP01881-3: 85160-4-PBS capture and 85160-5-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5365

  Product name: Recombinant human IRF9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-393 aa of BC035716

  Sequence: MASGRARCTRKLRNWVVEQVESGQFPGVCWDDTAKTMFRIPWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNKSSEFKEVPERGRMDVAEPYKVYQLLPPGIVSGQPGTQKVPSKRQHSSVSSERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEFLLPPEPDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGILVASNPRGLFVQRLCPIPISWNAPQAPPGPGPHLLPSNECVELFRTAYFCRDLVRYFQGLGPPPKFQVTLNFWEESHGSSHTPQNLITVKMEQAFARYLLEQTPEQQAAILSLV

• Full Name: IRF 9
• Calculated Molecular Weight: 393 aa, 44 kDa
• GenBank Accession Number: BC035716
• Gene Symbol: IRF9
• Gene ID (NCBI): 10379
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q00978
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.