IRG1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of RAW 264.7 using 86725-1-RR (same clone as 86725-1-PBS)

  LPS treated RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 86725-1-RR (IRG1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86725-1-PBS in a different storage buffer formulation.

• 

  WB analysis of THP-1 using 86725-1-RR (same clone as 86725-1-PBS)

  IFN gamma and LPS treated THP-1 cells were subjected to SDS PAGE followed by western blot with 86725-1-RR (IRG1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86725-1-PBS in a different storage buffer formulation.

• 

  IF Staining of RAW 264.7 using 86725-1-RR (same clone as 86725-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed LPS treated RAW 264.7 cells using IRG1 antibody (86725-1-RR, Clone: 251531C12 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 86725-1-PBS in a different storage buffer formulation.

IRG1 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86725-1-PBS

Clone No.251531C12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

ACOD1, CAD

---

Product Information

86725-1-PBS targets IRG1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag28913

  Product name: Recombinant human IRG1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 285-481 aa of NM_001258406

  Sequence: DAAASVRKHLVAERALLPTDYIKRIVLRIPNVQYVNRPFPVSEHEARHSFQYVACAMLLDGGITVPSFHECQINRPQVRELLSKVELEYPPDNLPSFNILYCEISVTLKDGATFTDRSDTFYGHWRKPLSQEDLEEKFRANASKMLSWDTVESLIKIVKNLEDLEDCSVLTTLLKGPSPPEVASNSPACNNSITNLS

• Full Name: immunoresponsive 1 homolog (mouse)
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: NM_001258406
• Gene Symbol: IRG1
• Gene ID (NCBI): 730249
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: A6NK06
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The host Immune-Responsive Gene 1 (IRG1; also called Acod1) is a mitochondrial enzyme induced under inflammatory conditions that produces the metabolite itaconate by decarboxylating cis-aconitate, a TCA cycle intermediate. Gene expression profiling studies of murine macrophages and microglial cells have revealed that IRG1 is highly expressed under pro-inflammatory conditions. Furthermore, IRG1 is highly expressed in the pregnant uterus during the early events leading to implantation, the specific phase of pregnancy in which high levels of inflammatory cytokines are secreted. IRG1 localizes to the mitochondria and may represent a key link between immunological and metabolic processes. IRG1 has crucial functions in embryonic implantation and neurodegeneration. Also, IRG1 promotes endotoxin tolerance by increasing A20 expression in macrophages via increased ROS production. (PMID: 25640654)