IRGM Polyclonal antibody

• Home
• Products
• Primary Antibodies
• IRGM Polyclonal antibody (25231-1-AP)

• 

  WB analysis using 25231-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25231-1-AP (IRGM antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

IRGM Polyclonal Antibody for WB, ELISA

Cat No. 25231-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

IFI1, IRGM1, LRG 47, LRG47

---

Tested Applications

• Positive WB detected in: RAW 264.7 cells, J774A.1 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25231-1-AP targets IRGM in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18631

  Product name: Recombinant human IRGM protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-181 aa of BC128168

  Sequence: MEAMNVEKASADGNLPEVISNIKETLKIVSRTPVNITMAGDSGNGMSTFISALRNTGHEGKASPPTELVKATQRCASYFSSHFSNVVLWDLPGTGSATTTLENYLMEMQFNRYDFIMVASAQFSMNHVMLAKTAEDMGKKFYIVWTKLDMDLSTGALPEVQLLQIRENVLENLQKERVCEY

• Full Name: immunity-related GTPase family, M
• Calculated Molecular Weight: 181 aa, 20 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC128168
• Gene Symbol: IRGM
• Gene ID (NCBI): 345611
• RRID: AB_3742142
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: A1A4Y4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.