IRSp53 Monoclonal antibody, PBS Only

• 

  WB analysis using 68348-1-Ig (same clone as 68348-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68348-1-Ig (IRSp53 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68348-1-PBS in a different storage buffer formulation.

• 

  WB analysis of LNCaP using 68348-1-Ig (same clone as 68348-1-PBS)

  LNCaP cells were subjected to SDS PAGE followed by western blot with 68348-1-Ig (IRSp53 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68348-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rabbit cerebellum using 68348-1-Ig (same clone as 68348-1-PBS)

  rabbit cerebellum tissue were subjected to SDS PAGE followed by western blot with 68348-1-Ig (IRSp53 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68348-1-PBS in a different storage buffer formulation.

IRSp53 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68348-1-PBS

Clone No.1D4G1

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat, Rabbit

Applications

WB, Indirect ELISA

Synonyms

BAI associated protein 2, BAI1 associated protein 2, BAIAP2, BAP2, Fas ligand associated factor 3, FLAF3, Insulin receptor substrate p53, IRS 58, IRSP53, IRSp53/58, Protein BAP2

---

Product Information

68348-1-PBS targets IRSp53 in WB, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat, Rabbit samples.

• Tested Reactivity: Human, Mouse, Rat, Rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25161

  Product name: Recombinant human BAIAP2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-300 aa of BC014020

  Sequence: MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQESTPIMN

• Full Name: BAI1-associated protein 2
• Calculated Molecular Weight: 61 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: BC014020
• Gene Symbol: IRSp53
• Gene ID (NCBI): 10458
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9UQB8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IRSp53 (also known as BAIAP2) is a multi-domain adaptor protein that originally identified as a 58/53-kDa substrate of insulin-receptor kinase in the hamster (PMID: 10332026). As a BAI1-binding protein, IRSp53 plays an important role in linking between membrane and cytoskeleton in the process of neuronal growth (PMID: 10343108). IRSp53 is necessary for Cdc42-mediated reorganization of the actin cytoskeleton and for Rac1-mediated membrane ruffling. Alternatively spliced isoforms of IRSp53 exist. IRSp53 has been implicated in several psychiatric disorders, including autism spectrum disorders (ASDs), schizophrenia, and attention deficit/hyperactivity disorder (ADHD) (PMID: 26275848).