IRSp53 Monoclonal antibody, PBS Only

IRSp53 Monoclonal Antibody for WB, Indirect ELISA
Cat No. 68348-1-PBS
Clone No.1D4G1

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat, Rabbit

Applications

WB, Indirect ELISA

BAI associated protein 2, BAI1 associated protein 2, BAIAP2, BAP2, Fas ligand associated factor 3, FLAF3, Insulin receptor substrate p53, IRS 58, IRSP53, IRSp53/58, Protein BAP2

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68348-1-PBS targets IRSp53 in WB, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat, Rabbit samples.

Tested Reactivity Human, Mouse, Rat, Rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag25161

Product name: Recombinant human BAIAP2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-300 aa of BC014020

Sequence: MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQESTPIMN

Predict reactive species
Full Name BAI1-associated protein 2
Calculated Molecular Weight 61 kDa
Observed Molecular Weight53 kDa
GenBank Accession NumberBC014020
Gene Symbol IRSp53
Gene ID (NCBI) 10458
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9UQB8
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

IRSp53 (also known as BAIAP2) is a multi-domain adaptor protein that originally identified as a 58/53-kDa substrate of insulin-receptor kinase in the hamster (PMID: 10332026). As a BAI1-binding protein, IRSp53 plays an important role in linking between membrane and cytoskeleton in the process of neuronal growth (PMID: 10343108). IRSp53 is necessary for Cdc42-mediated reorganization of the actin cytoskeleton and for Rac1-mediated membrane ruffling. Alternatively spliced isoforms of IRSp53 exist. IRSp53 has been implicated in several psychiatric disorders, including autism spectrum disorders (ASDs), schizophrenia, and attention deficit/hyperactivity disorder (ADHD) (PMID: 26275848).

Loading...
||
New chat Able
正在加载,请稍候...