Product Information
31699-1-PBS targets IRX1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag36597 Product name: Recombinant human IRX1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 190-300 aa of BC166635 Sequence: KVTWGARSKDQEDGALFGSDTEGDPEKAEDDEEIDLESIDIDKIDEHDGDQSNEDDEDKAEAPHAPAAPSALARDQGSPLAAADVLKPQDSPLGLAKEAPEPGSTRLLSPG Predict reactive species |
| Full Name | iroquois homeobox 1 |
| Observed Molecular Weight | 50 kDa |
| GenBank Accession Number | BC166635 |
| Gene Symbol | IRX1 |
| Gene ID (NCBI) | 79192 |
| RRID | AB_3670085 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | P78414 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Iroquois homeobox protein 1 (IRX1) is a member of the Iroquois homeobox family of transcription factors which plays a crucial role in embryonic development. IRX1 has been previously shown to function as a potential tumor suppressor in rheumatoid arthritis (RA), congenital heart disease (CHD), and tumors, such as gastric cancer (GC) and osteosarcoma (PMID: 25822025, PMID: 31640472). The molecular weight of IRX1 is 50 kDa.





