ISG15 Monoclonal antibody, PBS Only

ISG15 Monoclonal Antibody for WB, Indirect ELISA
Cat No. 68408-1-PBS
Clone No.3G9A2

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

WB, Indirect ELISA

G1P2, hUCRP, IFI15, IP17, ISG15, ISG15 ubiquitin like modifier, Ubiquitin like protein ISG15, UCRP

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68408-1-PBS targets ISG15 in WB, Indirect ELISA applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8953

Product name: Recombinant human ISG15 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-165 aa of BC009507

Sequence: MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS

Predict reactive species
Full Name ISG15 ubiquitin-like modifier
Calculated Molecular Weight 165 aa, 18 kDa
Observed Molecular Weight 13-17 kDa
GenBank Accession NumberBC009507
Gene Symbol ISG15
Gene ID (NCBI) 9636
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP05161
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ISG15 is a ubiquitin-like protein that becomes conjugated to many cellular proteins upon activation by interferon-alpha (IFNA) and -beta (IFNB). ISG15 forms covalent conjugates with its target proteins in a process called ISGylation, which in mammals is known to play a role in antiviral immunity. ISG15 proteins possess two ubiquitin-like (UBL) domains and a highly conserved C-terminal LRGG sequence, the latter being known as the ubiquitin conjugation motif. Intracellular ISG15 are conjugated, via the LRGG motif, to target proteins through a process called ISGylation, which resembles largely ubiquitination, the process of formation of ubiquitin conjugates. Unconjugated extracellular ISG15, which are released from several types of human and murine cells, are known to possess cytokine-like activity.

Loading...
||
New chat Able
正在加载,请稍候...