ISG15 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• ISG15 Recombinant monoclonal antibody (87799-1-RR)

• 

  WB analysis using 87799-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87799-1-RR (ISG15 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

ISG15 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87799-1-RR

Clone No.253357C11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

G1P2, hUCRP, IFI15, Interferon-induced 15 kDa protein, Interferon-induced 17 kDa protein

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87799-1-RR targets ISG15 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag8782

  Product name: Recombinant human ISG15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-165 aa of BC009507

  Sequence: MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS

• Full Name: ISG15 ubiquitin-like modifier
• Calculated Molecular Weight: 165 aa, 18 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC009507
• Gene Symbol: ISG15
• Gene ID (NCBI): 9636
• RRID: AB_3745757
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P05161
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ISG15 is a ubiquitin-like protein that becomes conjugated to many cellular proteins upon activation by interferon-alpha (IFNA) and -beta (IFNB). ISG15 forms covalent conjugates with its target proteins in a process called ISGylation, which in mammals is known to play a role in antiviral immunity. ISG15 proteins possess two ubiquitin-like (UBL) domains and a highly conserved C-terminal LRGG sequence, the latter being known as the ubiquitin conjugation motif. Intracellular ISG15 are conjugated, via the LRGG motif, to target proteins through a process called ISGylation, which resembles largely ubiquitination, the process of formation of ubiquitin conjugates. Unconjugated extracellular ISG15, which are released from several types of human and murine cells, are known to possess cytokine-like activity.