ISG20 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ISG20 Polyclonal antibody (22097-1-AP)

• Featured Product
• KD/KO Validated

ISG20 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 22097-1-AP Copied!

Publications (22)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IHC, IF, CoIP, ELISA

Synonyms

EC:3.1.13.1, Estrogen-regulated transcript 45 protein, HEM45, Interferon-stimulated gene 20 kDa protein, Promyelocytic leukemia nuclear body-associated protein ISG20

• 

  WB analysis of Raji using 22097-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 22097-1-AP (ISG20 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 22097-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22097-1-AP (ISG20 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 22097-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 22097-1-AP (ISG20 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 22097-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 22097-1-AP (ISG20 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ISG20 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Raji cells, Daudi cells
• Positive IHC detected in: human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22097-1-AP targets ISG20 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, canine, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17303

  Product name: Recombinant human ISG20 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-150 aa of BC007922

  Sequence: MAGSREVVAMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPFAVARLEILQLLKGKLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREAKLDHCRRVSLRVLSERLLHKSIQNSLLGHS

• Full Name: interferon stimulated exonuclease gene 20kDa
• Calculated Molecular Weight: 181 aa, 20 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC007922
• Gene Symbol: ISG20
• Gene ID (NCBI): 3669
• RRID: AB_2878994
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96AZ6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The ISG20 antibody (Cat# 22097-1-AP) has accumulated 22 citations published across 19 journals, including Redox Biology, Molecular Cell, Nucleic Acids Research, Cell Reports, EMBO Reports, PLoS Pathogens, and Journal of Virology. Associated research fields encompass antiviral immunity, RNA biology, renal fibrosis, oncology (ovarian cancer, glioma, renal cell carcinoma), innate immune signaling, and macrophage polarization. Key studies examine roles in HIV-1, ZIKA, influenza A, BK polyomavirus, and flavivirus infections.

Automatically generated from the 22 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Redox Biol; Activation of sclerostin inhibits Isg20-Mediated aerobic glycolysis ameliorating renal Fibrosis: the renoprotective mechanism of hederagenin in CKD; Authors - Rang-Yue Han
		Mol Cell; RNA exonuclease REXO4 resolves m(6)A-marked R-loops and suppresses anti-tumor immunity.; Authors - Jieyou Zhang
human	WB	Nucleic Acids Res; Internal RNA 2'O-methylation in the HIV-1 genome counteracts ISG20 nuclease-mediated antiviral effect; Authors - Priscila El Kazzi ; KD Validated
		Cell Rep; MITD1 restricts HIV-1 release by targeting ESCRT-III proteins.; Authors - Jim Zoladek
mouse	WB,IF,CoIP	Cell Rep; Enzymolysis-based RNA pull-down identifies YTHDC2 as an inhibitor of antiviral innate response; Authors - Jun Zhu
human	WB,IHC	Cancer Cell Int; Identification and validation of a novel glycolysis-related gene signature for predicting the prognosis in ovarian cancer.; Authors - Jing Yu