• Featured Product
  • KD/KO Validated

ISG20 Polyclonal antibody

ISG20 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 22097-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IHC, IF, CoIP, ELISA

EC:3.1.13.1, Estrogen-regulated transcript 45 protein, HEM45, Interferon-stimulated gene 20 kDa protein, Promyelocytic leukemia nuclear body-associated protein ISG20

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inRaji cells, Daudi cells
Positive IHC detected inhuman colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22097-1-AP targets ISG20 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, canine, monkey
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag17303

Product name: Recombinant human ISG20 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-150 aa of BC007922

Sequence: MAGSREVVAMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPFAVARLEILQLLKGKLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREAKLDHCRRVSLRVLSERLLHKSIQNSLLGHS

Predict reactive species
Full Name interferon stimulated exonuclease gene 20kDa
Calculated Molecular Weight 181 aa, 20 kDa
Observed Molecular Weight 20 kDa
GenBank Accession NumberBC007922
Gene Symbol ISG20
Gene ID (NCBI) 3669
RRIDAB_2878994
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96AZ6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for ISG20 antibody 22097-1-APDownload protocol
WB protocol for ISG20 antibody 22097-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

EMBO Rep

Placenta-derived interferon-stimulated gene 20 controls ZIKA virus infection.

Authors - Jiahui Ding
  • KO Validated
humanWB

PLoS Pathog

PMID: 31600344

Authors - Nannan Wu
humanWB

J Virol

Lnc-ISG20 inhibits influenza A virus replication by enhancing ISG20 expression.

Authors - Wenjia Chai
  • KD Validated
humanWB,IHC

Cancer Cell Int

Identification and validation of a novel glycolysis-related gene signature for predicting the prognosis in ovarian cancer.

Authors - Jing Yu
humanWB

Ann Transl Med

Identification of key biomarkers and immune infiltration in renal interstitial fibrosis.

Authors - Zhanhong Hu
humanIHC

Oncoimmunology

Development and validation of an interferon signature predicting prognosis and treatment response for glioblastoma.

Authors - Chen Zhu
Loading...
||
New chat Able
正在加载,请稍候...