ISG20 Polyclonal antibody

• 

  WB analysis of Raji using 22097-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 22097-1-AP (ISG20 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 22097-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22097-1-AP (ISG20 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon using 22097-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 22097-1-AP (ISG20 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human colon using 22097-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 22097-1-AP (ISG20 Antibody) at dilution of 1:50 (under 10x lens).

• Featured Product
• KD/KO Validated

ISG20 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 22097-1-AP

Publications(16)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IHC, IF, CoIP, ELISA

Synonyms

EC:3.1.13.1, Estrogen-regulated transcript 45 protein, HEM45, Interferon-stimulated gene 20 kDa protein, Promyelocytic leukemia nuclear body-associated protein ISG20

---

Tested Applications

• Positive WB detected in: Raji cells, Daudi cells
• Positive IHC detected in: human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 12 publications below
• IHC: See 5 publications below
• IF: See 2 publications below
• CoIP: See 1 publications below

Product Information

22097-1-AP targets ISG20 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, canine, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17303

  Product name: Recombinant human ISG20 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-150 aa of BC007922

  Sequence: MAGSREVVAMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPFAVARLEILQLLKGKLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREAKLDHCRRVSLRVLSERLLHKSIQNSLLGHS

• Full Name: interferon stimulated exonuclease gene 20kDa
• Calculated Molecular Weight: 181 aa, 20 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC007922
• Gene Symbol: ISG20
• Gene ID (NCBI): 3669
• RRID: AB_2878994
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96AZ6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	EMBO Rep; Placenta-derived interferon-stimulated gene 20 controls ZIKA virus infection.; Authors - Jiahui Ding ; KO Validated
human	WB	PLoS Pathog; PMID: 31600344; Authors - Nannan Wu
human	WB	J Virol; Lnc-ISG20 inhibits influenza A virus replication by enhancing ISG20 expression.; Authors - Wenjia Chai ; KD Validated
human	WB,IHC	Cancer Cell Int; Identification and validation of a novel glycolysis-related gene signature for predicting the prognosis in ovarian cancer.; Authors - Jing Yu
human	WB	Ann Transl Med; Identification of key biomarkers and immune infiltration in renal interstitial fibrosis.; Authors - Zhanhong Hu
human	IHC	Oncoimmunology; Development and validation of an interferon signature predicting prognosis and treatment response for glioblastoma.; Authors - Chen Zhu