Islet 2 Polyclonal antibody

• 

  WB analysis of Neuro-2a using 18659-1-AP

  Neuro-2a cells were subjected to SDS PAGE followed by western blot with 18659-1-AP (Islet 2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Neuro-2a using 18659-1-AP

  Neuro-2a cells were subjected to SDS PAGE followed by western blot with 18659-1-AP (ISL2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

Islet 2 Polyclonal Antibody for WB, ELISA

Cat No. 18659-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

ISL2, Islet-2, ISL LIM homeobox 2, Insulin gene enhancer protein ISL-2

---

Tested Applications

• Positive WB detected in: Neuro-2a cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18659-1-AP targets Islet 2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13333

  Product name: Recombinant human ISL2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-359 aa of BC012136

  Sequence: MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIHDQFILRVSPDLEWHAACLKCAECSQYLDETCTCFVRDGKTYCKRDYVRLFGIKCAKCQVGFSSSDLVMRARDSVYHIECFRCSVCSRQLLPGDEFSLREHELLCRADHGLLLERAAAGSPRSPGPLPGARGLHLPDAGSGRQPALRPHVHKQTEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKKSILMKQLQQQQHSDKTSLQGLTGTPLVAGSPIRHENAVQGSAVEVQTYQPPWKALSEFALQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVET

• Full Name: ISL LIM homeobox 2
• Calculated Molecular Weight: 40 kDa
• Observed Molecular Weight: 40-45 kDa
• GenBank Accession Number: BC012136
• Gene Symbol: ISL2
• Gene ID (NCBI): 64843
• RRID: AB_2878556
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96A47
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.