ISLR Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83782-5-RR (same clone as 83782-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83782-5-RR (ISLR antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83782-5-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse retina using 83782-5-RR (same clone as 83782-5-PBS)

  mouse retina tissue were subjected to SDS PAGE followed by western blot with 83782-5-RR (ISLR antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83782-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse eye using 83782-5-RR (same clone as 83782-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse eye tissue slide using 83782-5-RR (ISLR antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83782-5-PBS in a different storage buffer formulation.

• 

  IF Staining of NIH/3T3 using 83782-5-RR (same clone as 83782-5-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using ISLR antibody (83782-5-RR, Clone: 240727D4 ) at dilution of 1:250 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 83782-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83782-5-PBS

  Biolayer interferometry (BLl) kinetic assays of 83782-5-PBS against Human ISLR were performed. The affinity constant is 1.30 nM.

• 

  Affinity and Kinetic Characterization of 83782-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83782-5-RR against Human ISLR were performed. The affinity constant is 0.369 nM.

ISLR Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 83782-5-PBS

Clone No.240727D4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

240727D4, HsT17563, Immunoglobulin superfamily containing leucine-rich repeat protein, UNQ189/PRO215

---

Product Information

83782-5-PBS targets ISLR in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag19446

  Product name: Recombinant human ISLR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 318-402 aa of BC022478

  Sequence: GKLEEGTYSCLATNELGSAESSVDVALATPGEGGEDTLGRRFHGKAVEGKGCYTVDNEVQPSGPEDNVVIIYLSRAGNPEAAVAE

• Full Name: immunoglobulin superfamily containing leucine-rich repeat
• Calculated Molecular Weight: 428 aa, 46 kDa
• Observed Molecular Weight: 44-46 kDa
• GenBank Accession Number: BC022478
• Gene Symbol: ISLR
• Gene ID (NCBI): 3671
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O14498
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The Immunoglobulin superfamily containing leucine-rich repeat protein(ISLR), is involved in various biological events, such as embryonic development, Gaucher's disease, and replicative senescence of fibroblasts in some organs, including the heart, pancreas, and bone marrow. ISLR, also known as meflin, is a newly discovered marker of mesenchymal stem cells, which is involved in pathological fibrosis and the cancer microenvironment. (PMID: 34713300)