CD103 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CD103 Recombinant monoclonal antibody (87417-1-RR)

• 

  WB analysis using 87417-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87417-1-RR (ITAE antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse spleen using 87417-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 87417-1-RR (CD103 antibody) at dilution of 1:3000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CD103 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 87417-1-RR

Clone No.252752B6

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, ELISA

Synonyms

Itgae, alpha E1, alpha M290, aM290, Integrin alpha E

---

Tested Applications

• Positive WB detected in: mouse thymus tissue, mouse spleen tissue
• Positive IHC detected in: mouse spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:1500-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87417-1-RR targets CD103 in WB, IHC, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg10465

  Product name: Recombinant mouse ITAE protein

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-Twin-Strep-Tag

  Domain: 669-1114 aa of

  Sequence: RPVVDLTVSMTFTPDALPMVFIGKMDVKLCFEVDSSGVASEPGLREMFLNFTVDVDVTKQRQRLQCEDSSGCQSCLRKWNGGSFLCEHFWLISTEELCEEDCFSNITIKVTYEFQTSGGRRDYPNPTLDHYKEPSAIFQLPYEKDCKNKVFCIAEIQLTTNISQQELVVGVTKEVTMNISLTNSGEDSYMTNMALNYPRNLQFKKIQKPVSPDVQCDDPKPVASVLVMNCKIGHPILKRSSVNVSVTWQLEESVFPNRTADITVTISNSNEKSLARETRSLQFRHAFIAVLSRPSVMYMNTSQSPSDHKEFFFNVHGENLFGAVFQLQICVPIKLQDFQIVRVKNLTKTQDHTECTQSQEPACGSDPVQHVKEWHSVVCAITSNKENVTVAAEISVGHTKQLLRDVSELPILGEISFNKSLYEGLNAENHRTKITVIFLKEEETRS

• Full Name: integrin alpha E, epithelial-associated
• Observed Molecular Weight: 160 kDa
• Gene Symbol: CD103
• Gene ID (NCBI): 16407
• RRID: AB_3745529
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD103, also known as integrin alpha-E (ITGAE) or integrin alpha-IEL, is a type I transmembrane integrin protein that binds integrin beta 7 to form Integrin alpha-E beta-7 which is a receptor for E-cadherin and mediates adhesion of T lymphocytes to epithelial cells (PMID: 7969453; 8468482). CD103 is expressed on intraepithelial lymphocyte (IEL) T cells (both alpha/beta T cells and gamma/delta T cells), some peripheral regulatory T cells (Tregs), lamina propria T cells, and a subset of dendritic cells in the gut mucosa and mesenteric lymph nodes (PMID: 12242333; 15608520; 16216890).