ITFG1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ITFG1 Polyclonal antibody, PBS Only (11731-1-PBS)

• 

  WB analysis of mouse testis using 11731-1-AP (same clone as 11731-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 11731-1-AP (ITFG1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11731-1-PBS in a different storage buffer formulation.

ITFG1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 11731-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

11731-1-PBS targets ITFG1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2331

  Product name: Recombinant human ITFG1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 313-612 aa of BC024162

  Sequence: LWGFVPFVDEQQPTEIPIPITLHIGDYNMDGYPDALVILKNTSGSNQQAFLLENVPCNNASCEEARRMFKVYWELTDLNQIKDAMVATFFDIYEDGILDIVVLSKGYTKNDFAIHTLKNNFEADAYFVKVIVLSGLCSNDCPRKITPFGVNQPGPYIMYTTVDANGYLKNGSAGQLSQSAHLALQLPYNVLGLGRSANFLDHLYVGIPRPSGEKSIRKQEWTAIIPNSQLIVIPYPHNVPRSWSAKLYLTPSNIVLLTAIALIGVCVFILAIIGILHWQEKKADDREKRQEAHRFHFDAM

• Full Name: integrin alpha FG-GAP repeat containing 1
• Calculated Molecular Weight: 612 aa, 68 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC024162
• Gene Symbol: ITFG1
• Gene ID (NCBI): 81533
• RRID: AB_2233806
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TB96
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.