ITFG2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ITFG2 Polyclonal antibody, PBS Only (32836-1-PBS)

• 

  WB analysis using 32836-1-AP (same clone as 32836-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32836-1-AP (ITFG2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32836-1-PBS in a different storage buffer formulation.

ITFG2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32836-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Integrin-alpha FG-GAP repeat-containing protein 2, KICSTOR complex protein ITFG2, MDS028

---

Product Information

32836-1-PBS targets ITFG2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36829

  Product name: Recombinant human ITFG2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 210-362 aa of BC006552

  Sequence: LLCTWKKDTGSPPASEGPTDGSRETPAARDVVLHQTSGRIHNKNVSTHLIGNIKQGHGTESSGSGLFALCTLDGTLKLMEEMEEADKLLWSVQVDHQLFALEKLDVTGNGHEEVVACAWDGQTYIIDHNRTVVRFQVDENIRAFCAGLYACKE

• Full Name: integrin alpha FG-GAP repeat containing 2
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC006552
• Gene Symbol: ITFG2
• Gene ID (NCBI): 55846
• RRID: AB_3742757
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q969R8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Integrin-alpha FG-GAP repeat-containing protein 2 (ITFG2) is an immune-modulatory intracellular protein that modulates the fate of B cells and negatively regulates mTORC1 signaling (PMID: 23997217; 28199306). ITFG2 is highly expressed in the heart, which may be a novel strategy for the clinical management of myocardial infarction (PMID: 38848780).