Integrin Alpha 9 Polyclonal antibody

• 

  WB analysis of human liver using 14593-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 14593-1-AP (ITGA9 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 14593-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 14593-1-AP (ITGA9 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IF Staining of A549 using 14593-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed A549 cells using 14593-1-AP (Integrin alpha-9 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

Integrin Alpha 9 Polyclonal Antibody for WB, IF, ELISA

Cat No. 14593-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IF, IHC, ELISA

Synonyms

ALPHA RLC, Integrin alpha 9, Integrin alpha RLC, integrin, alpha 9, ITGA4L, ITGA9, RLC

---

Tested Applications

• Positive WB detected in: human liver tissue, A549 cells
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 4 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

14593-1-AP targets Integrin Alpha 9 in WB, IF, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6126

  Product name: Recombinant human Integrin alpha-9 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 12-352 aa of BC030198

  Sequence: RLRALLLALVVAGIPAGAYNLDPQRPVHFQGPADSFFGYAVLEHFHDNTRWVLVGAPKADSKYSPSVKSPGAVFKCRVHTNPDRRCTELDMARGKNRGTSCGKTCREDRDDEWMGVSLARQPKADGRVLACAHRWKNIYYEADHILPHGFCYIIPSNLQAKGRTLIPCYEEYKKKYGEEHGSCQAGIAGFFTEELVVMGAPGSFYWAGTIKVLNLTDNTYLKLNDEVIMNRRYTYLGYAVTAGHFSHPSTIDVVGGAPQDKGIGKVYIFRADRRSGTLIKIFQASGKKMGSYFGSSLCAVDLNGDGLSDLLVGAPMFSEIRDEGQVTVYINRGNGALEEQL

• Full Name: integrin, alpha 9
• Calculated Molecular Weight: 114 kDa
• Observed Molecular Weight: 100-110 kDa
• GenBank Accession Number: BC030198
• Gene Symbol: Integrin alpha 9
• Gene ID (NCBI): 3680
• RRID: AB_2128460
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13797
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Adv Healthc Mater; Modification of PLGA Scaffold by MSC-Derived Extracellular Matrix Combats Macrophage Inflammation to Initiate Bone Regeneration via TGF-β-Induced Protein.; Authors - Moyuan Deng
rat	WB	Biofactors; Tenascin-C regulates migration of SOX10 tendon stem cells via integrin-α9 for promoting patellar tendon remodeling.; Authors - Kang Xu
human	WB	Tumour Biol; MicroRNA-125b suppresses the epithelial-mesenchymal transition and cell invasion by targeting ITGA9 in melanoma.; Authors - Jie Zhang
human	WB,IHC,IF	Inflammation; Integrin-α9 and Its Corresponding Ligands Play Regulatory Roles in Chronic Periodontitis.; Authors - Shihan Xu ; KD Validated