Tested Applications
| Positive WB detected in | TF-1 cells, THP-1 cells |
| Positive IHC detected in | human tonsillitis tissue, Insulinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human tonsillitis tissue |
| Positive IF/ICC detected in | THP-1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21851-1-AP targets CD11b in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, pig, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16327 Product name: Recombinant human CD11B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 127-320 aa of BC096346 Sequence: GSNLRQQPQKFPEALRGCPQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFEA Predict reactive species |
| Full Name | integrin, alpha M (complement component 3 receptor 3 subunit) |
| Calculated Molecular Weight | 1152 aa, 127 kDa |
| Observed Molecular Weight | 170 kDa |
| GenBank Accession Number | BC096346 |
| Gene Symbol | CD11b |
| Gene ID (NCBI) | 3684 |
| ENSEMBL Gene ID | ENSG00000169896 |
| RRID | AB_2878927 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P11215 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Integrins are cell adhesion receptors that are heterodimers composed of non-covalently associated α and β subunits (PMID: 9779984). CD11b, also known as Integrin alpha M or CR3A, belongs to the integrin alpha chain family. CD11b forms an α/β heterodimer with CD18 (integrin β2). CD11b/CD18 is implicated in various adhesive interactions of monocytes, macrophages and granulocytes as well as in mediating the uptake of complement-coated particles and pathogens (PMID: 9558116; 20008295). CD11b/CD18 is a receptor for the complement protein fragment iC3b, and is also a receptor for fibrinogen, factor X and ICAM1 (PMID: 2971974; 15485828).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD11b antibody 21851-1-AP | Download protocol |
| IHC protocol for CD11b antibody 21851-1-AP | Download protocol |
| WB protocol for CD11b antibody 21851-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CD11b Polyclonal antibody (Cat# 21851-1-AP) has accumulated 58 citations across journals including Cancer Cell, Cell Mol Immunol, ACS Nano, Sci Adv, Biomaterials, Int Immunopharmacol, Front Immunol, Int J Mol Sci, and Metabolism. Research fields span immunology (macrophage polarization, tumor microenvironment), oncology (lung, breast, liver, pancreatic, cervical cancer), inflammation, liver disease (NASH, fatty liver), neuroscience (neuroinflammation, stroke), wound healing, and cardiovascular biology.
| Species | Application | Title |
|---|---|---|
Cancer Cell Multimodal spatial-omics reveal co-evolution of alveolar progenitors and proinflammatory niches in progression of lung precursor lesions. | ||
Cell Mol Immunol Intestinal taurine acts as a novel immunometabolic modulator of IBD by degrading redundant mitochondrial RNA | ||
ACS Nano Biomimetic Ginsenoside Rb1 and Probucol Co-Assembled Nanoparticles for Targeted Atherosclerosis Therapy via Inhibition of Oxidative Stress, Inflammation, and Lipid Deposition | ||
Metabolism METTL1-mediated m7G methylation of FoxO1 regulates lipid metabolism in metabolic dysfunction-associated fatty liver disease. | ||
Gut Microbes Bifidobacterium spp. and their metabolite lactate protect against acute pancreatitis via inhibition of pancreatic and systemic inflammatory responses |
